SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000004318 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000004318
Domain Number 1 Region: 359-539
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.35e-63
Family SPRY domain 0.00000381
Further Details:      
 
Domain Number 2 Region: 142-207
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 4.27e-17
Family B-box zinc-binding domain 0.00051
Further Details:      
 
Domain Number 3 Region: 10-79
Classification Level Classification E-value
Superfamily RING/U-box 4.42e-16
Family RING finger domain, C3HC4 0.0081
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000004318
Domain Number - Region: 275-313
Classification Level Classification E-value
Superfamily Ribbon-helix-helix 0.0245
Family Arc/Mnt-like phage repressors 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000004318   Gene: ENSGACG00000003300   Transcript: ENSGACT00000004332
Sequence length 543
Comment pep:novel group:BROADS1:groupV:2818547:2820505:1 gene:ENSGACG00000003300 transcript:ENSGACT00000004332 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASANYGPSEAQFLCSICLDVFTDPVSTPRGRNFCINCINEHWNTSDQNLCPTCKKNFIT
RPNLRVNTMFSEMVVKFRESAQQKASSSSSEQQESKPREVPCDVCTGTKMKALKSCLVCL
VSYCETHLEPHLTMSGLKRHQLMDPVENLKGRMCKKHDKPLELFCKSDRTCVCMLCSVLD
HKMHDVVPVEEEYEEKKVELKKTEAEIQQMIQKRRVKIQEIKHSVDLSEEDAGREKAEGV
QVFNDLMESVGRGLKELLKTIEEKQETTKKQAEAFIRELEEEISELMKRSAEVEQLSLSE
DHLHLLQSSNIHQPPPTKDWTEVSVCPSSYEGTVVRAVSQLEETLSKKMKKWFAELMKVQ
MFSVDLTLDPQTAHPNLILSDDGKQVKHGNVWKKLPNNPERFYYWLCVSTKQSFSSGKFY
FEVQVEGKTEWYLGVARKSVDRKGHISLSPQKGYWTIWLRNKYNASADPSVVLSLKSRPQ
KVGVFVNYEEGVVSFYDVEAAALIYSFTGCSFTEKLFPFFNPGDNKNGGNSAPLIISPVR
SSE
Download sequence
Identical sequences G3NG63
ENSGACP00000004318 ENSGACP00000004318 69293.ENSGACP00000004318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]