SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000004734 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000004734
Domain Number 1 Region: 22-71
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000502
Family Laminin-type module 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000004734   Gene: ENSGACG00000003617   Transcript: ENSGACT00000004748
Sequence length 234
Comment pep:known_by_projection group:BROADS1:groupXIII:933004:934693:1 gene:ENSGACG00000003617 transcript:ENSGACT00000004748 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGPRCDQCSAGFYKHSGVCVPCDCSGNADPQGPPQVCQPDTGQCLRCINGTSGPQCQRCA
PGFVGDARAHNCTRPTPRLLLTPEHTTTSETPSTTAGTALTSTTAGGNASTPLSAAATTQ
ALLTSPSSPTDNTTAALTEVSWTQFNIIILAVIILVVLVLLGFVGGVYTYREYQNRKLNA
PFWTIELKEDNISFSSYHDSIPNADASGLLEDEANEVTPNGQLALTTQGNCYKA
Download sequence
Identical sequences G3NHC6
69293.ENSGACP00000004734 ENSGACP00000004734 ENSGACP00000004734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]