SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000005225 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000005225
Domain Number 1 Region: 381-523
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.85e-23
Family MAM domain 0.0033
Further Details:      
 
Domain Number 2 Region: 166-206
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000215
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 3 Region: 47-206
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000033
Family Growth factor receptor domain 0.0098
Further Details:      
 
Domain Number 4 Region: 211-257
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000109
Family EGF-type module 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000005225   Gene: ENSGACG00000003978   Transcript: ENSGACT00000005240
Sequence length 531
Comment pep:known_by_projection group:BROADS1:groupXVI:8898223:8905490:-1 gene:ENSGACG00000003978 transcript:ENSGACT00000005240 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQLLTLHLAALYFIVHISSASGGAHRPSRQVLTGNQPGVCRYGRRLECCYGWKKNSKGQC
EAQCDHGCKHGECVGPNKCKCFPGHSGKTCNQDLNECGLKPRPCEHRCMNTYGSYKCYCL
NGYTVMPDGSCANSRTCSAAHCQYGCEEVQEEIRCLCPSAGLQLGQDRRTCIDIDECVTG
NNLCPYNRQCVNTFGSYFCKCRSGYDLKYVEGKYDCVDLDECASSTHKCSHHAVCANTRG
SYKCSCKSGFRGNGFECSAKPFYQRSWDGDKGSADEFLNVIQDSQVKPGILGGTLDNDDI
KNIITEPVATPAPNIHQQPFDYDGEVYIGPGTDQGQVDEIQNNQLNSRGDVFISEEFESV
FGPATEVKEFHITPVQEEFIIDCNFDQGACEWVQDKADDMDWSVAYHNSAEYYMAMSGLL
GESEDTAKLKLLLSDKAQQGSFCLTFDYRVVGRNVGTLRVLLGNSAYPVWEQSQSRDQGW
QTELLTVAWKEEAPQSVVFEAQRGKEVGGEIGLDNVVLTSGPCQDDFCLPF
Download sequence
Identical sequences G3NIR5
ENSGACP00000005225 69293.ENSGACP00000005225 ENSGACP00000005225

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]