SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000005232 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000005232
Domain Number 1 Region: 166-207
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000839
Family EGF-type module 0.0079
Further Details:      
 
Domain Number 2 Region: 47-205
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000942
Family Growth factor receptor domain 0.0098
Further Details:      
 
Domain Number 3 Region: 211-257
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000301
Family EGF-type module 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000005232   Gene: ENSGACG00000003978   Transcript: ENSGACT00000005247
Sequence length 321
Comment pep:known_by_projection group:BROADS1:groupXVI:8900185:8905286:-1 gene:ENSGACG00000003978 transcript:ENSGACT00000005247 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQLLTLHLAALYFIVHISSASGGAHRPSRQVLTGNQPGVCRYGRRLECCYGWKKNSKGQC
EAQCDHGCKHGECVGPNKCKCFPGHSGKTCNQDLNECGLKPRPCEHRCMNTYGSYKCYCL
NGYTVMPDGSCANSRTCSAAHCQYGCEEVQEEIRCLCPSAGLQLGQDRRTCIDIDECVTG
NNLCPYNRQCVNTFGSYFCKCRSGYDLKYVEGKYDCVDLDECASSTHKCSHHAVCANTRG
SYKCSCKSGFRGNGFECSVIQDSQVKPGILGGTLDNDDIKNIITEPVATPAPNIHQQPFD
YDGEVYIGPGTDQGQAGEEGR
Download sequence
Identical sequences G3NIS2
ENSGACP00000005232

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]