SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000005236 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000005236
Domain Number 1 Region: 459-789
Classification Level Classification E-value
Superfamily L domain-like 3.29e-42
Family Ngr ectodomain-like 0.019
Further Details:      
 
Domain Number 2 Region: 56-443
Classification Level Classification E-value
Superfamily L domain-like 6.8e-35
Family Ngr ectodomain-like 0.002
Further Details:      
 
Domain Number 3 Region: 849-1004
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 3.14e-28
Family Toll/Interleukin receptor TIR domain 0.000095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000005236   Gene: ENSGACG00000003992   Transcript: ENSGACT00000005251
Sequence length 1019
Comment pep:known_by_projection group:BROADS1:groupXVI:8917742:8920801:-1 gene:ENSGACG00000003992 transcript:ENSGACT00000005251 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLLFSLCTHHEIQPAACKPTWMRAQFPCDVRAYNNSEVLFDCHDRRLYMVPHGITANATE
LNLSNNNIGNIWADSFSNLSNLTRLNLGWANKKENKTVTIAANAFKNLTKLQHLMLMCIG
LTEIPKNLPLSLGTLDLSVNKITLPENWSFNGLRNVTHLMLSRNCYSGNPCGKSVRIRED
SFAVMHKLQHLDLSSNNLTEVPVGLPNSLIMLKLGKNQIQAISGDAFLGLPNLEVLKIEG
NCPRCQNAPFPCVPCQNGSLSIHLNAFQNLTKLKTLNLGGNSLDHLNPSWFESLSELKEL
FLSFNFLLKTITGEATFLRHLPKLELVDISFNFALMLYPVTIHLSKEFSKLSNLRTLHLE
GLVFQNIGSHTLKSLYGLYNLSALNLGTNFIIQSDSNIFKQFRHLKMLYLAENRLYPIPG
KNSSHLTYGYNQGSDLFIPPLTYPENRDFELSHLLIKQECFNSGRVLVLSSNNLFFISRE
QFQGYGDIACLNLSSNGFSAALNGTEFSLLPNLTYLDLSFNKIDLAYNNAFKELKQLQVL
DLSNNDHYFKKFGITLNLNFIKNLPVLRVLNMSHNSISRLTTKRMYSKSLTELQFSHNLL
GTLWKEEFGSYKMLFTNLTNLTILDISHNCIKKIPENVYEYLPPNLTMLHVHHNFLTDFR
WDKLMRFHQLQILDLSFNNIYNVTGINLNISLTYLDLSHNHIFHLENGFLKGARSLSTLI
LSNNKLTTINESTFQSRPESQIQTLFLQGNPFQCTCDSLDFILWIENSDVKIPRLTSKVT
CDTPANMKGNALIYFGIDQCVNDSEAFMIYILTNSFIIVFMFVATLAHLFYWDASYVLHY
MKAKLKGYKSLNSPDSVYGVFVMYDTRDPHVSEWVMTNLRVKLEEEGDMYLPLCLEERDW
ALGAPLVENLSQSIRYSSKTLFVLTEAYVKTGVFKLAMCLAHQRLLDENKDVIVLLMLEP
VLQNSHFLRLRKRMCRKSVLEWPKTPAAEPWFWTTLRNVVKVDNQAICNKTYKKYFTVK
Download sequence
Identical sequences G3NIS6
ENSGACP00000005236 ENSGACP00000005236 69293.ENSGACP00000005236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]