SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000005248 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000005248
Domain Number 1 Region: 484-783
Classification Level Classification E-value
Superfamily L domain-like 7.82e-45
Family Ngr ectodomain-like 0.014
Further Details:      
 
Domain Number 2 Region: 28-433
Classification Level Classification E-value
Superfamily L domain-like 1.13e-36
Family Ngr ectodomain-like 0.0036
Further Details:      
 
Domain Number 3 Region: 873-1024
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 2.49e-34
Family Toll/Interleukin receptor TIR domain 0.0000915
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000005248   Gene: ENSGACG00000003996   Transcript: ENSGACT00000005263
Sequence length 1038
Comment pep:known_by_projection group:BROADS1:groupXVI:8922565:8926372:-1 gene:ENSGACG00000003996 transcript:ENSGACT00000005263 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGFHFLMQMCVALLATWCCLSITTAIVSYPKTLPCDVVEGHNGSTVTVDCTERSLRGIPR
GIPRDTTNLTLTINHIPKLNSTSFSALENLKEIDMRCNCVPIKIGPKDRMCTQSVIIEEN
TFASLKELRALYLDGNQLYTIPKGLPQSLILLSLEVNHIYNISKVNLSEIRNIQMLYLSQ
NCYYRNPCNASYAIEDGAFLQLNNLTLLCLKSNNLSFIPHQLPPSLKELYLYNNNIQVVT
GDDFKNLTELQILDISGNCPRCYNAPFPCIPCPNNSPLNISKAAFKMLTKLTTLRLHSNS
LTCVQSEWFASTPELRELDLSSNFLARAIGFTDFPRYLGKLEELDLSFNYELQRYPETLR
LSCSFSYLESLRILRLKGFVFQQLQSESIAPLKHLPNLEVVDLGTNFIKMTNLSILMELK
SFKIISLSDNKISSPSDGLDGVGFSGGEPLYWSPMSASAQYQNTMNTPAAANTKIKKNCS
QFGKTLDVSRNNIFFLHSRFLNFGELRCLNLSGNAMSQSLNGSEFTYLTNLQYLDFSYNR
LDLLYSTAFQELKNLVILDISYNNHYFESEGLTHMLNFTRNLKKLKVLLMNNNKISTSTN
TELESQSLERLEFRNNRLDMLWRDGDTRYVNYFKNLLNLTVLDISQNNLNFIPPEVFSGL
PDKLSELYLKNNQLKDESFNWEKLQLLQSLQVLDLSGNSLTSVPPMLSICSKSLKKLLLH
KNQILKLTPDFLKDAHKLEYLDLSYNHIQHIEKSSFPDDVVDKMQKLLLHNNRFLCTCNA
TWFITWLNRTTVTIPRLATDVTCASPGAQRGQSVISVDLLACQHSYLSITLYTLMTSLVL
SFLTLSISSHLFLWDVWYIYHFCRAKFKGYRRLRSQSSAYDAFVMYDKEDSAVTEWVMKE
MCAHLEERGDRRLTLCLEERDWIPGCPLIDNLSQSIHNSKRTVFILTSSYLKSGNFKTAF
YMANQRLMDEKNDVIVLIFLEKVACNSKYLRLRKRLFKRSVLEWPTNPQAQLYFWFSLRS
VLATESHKQYNNLFKETL
Download sequence
Identical sequences G3NIT8
ENSGACP00000005248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]