SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000005259 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000005259
Domain Number 1 Region: 488-787
Classification Level Classification E-value
Superfamily L domain-like 6.12e-44
Family Ngr ectodomain-like 0.014
Further Details:      
 
Domain Number 2 Region: 47-86,125-361,395-436
Classification Level Classification E-value
Superfamily L domain-like 1.26e-34
Family Ngr ectodomain-like 0.0091
Further Details:      
 
Domain Number 3 Region: 877-1028
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 2.49e-34
Family Toll/Interleukin receptor TIR domain 0.0000915
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000005259   Gene: ENSGACG00000003996   Transcript: ENSGACT00000005274
Sequence length 1042
Comment pep:known_by_projection group:BROADS1:groupXVI:8922565:8926033:-1 gene:ENSGACG00000003996 transcript:ENSGACT00000005274 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VELLLLRHQTLMCVALLATWCCLSITTAIVSYPKTLPCDVVEGHNGSTVTVDCTERSLRG
IPRGIPRDTTNLTLTINHIPKLNSTSFSALENLKEIDMRCNCVPIKIGPKDRMCTQSVII
EENTFASLKELRALYLDGNQLYTIPKGLPQSLILLSLEVNHIYNISKVNLSEIRNIQMLY
LSQNCYYRNPCNASYAIEDGAFLQLNNLTLLCLKSNNLSFIPHQLPPSLKELYLYNNNIQ
VVTGDDFKNLTELQILDISGNCPRCYNAPFPCIPCPNNSPLNISKAAFKMLTKLTTLRLH
SNSLTCVQSEWFASTPELRELDLSSNFLARAIGFTDFPRYLGKLEELDLSFNYELQRYPE
TLRLSCSFSYLESLRILRLKGFVFQQLQSESIAPLKHLPNLEVVDLGTNFIKMTNLSILM
ELKSFKIISLSDNKISSPSDGLDGYQSKEVREMHYFRYDEYARSCKYKDKELGKITFFVN
KNCSQFGKTLDVSRNNIFFLHSRFLNFGELRCLNLSGNAMSQSLNGSEFTYLTNLQYLDF
SYNRLDLLYSTAFQELKNLVILDISYNNHYFESEGLTHMLNFTRNLKKLKVLLMNNNKIS
TSTNTELESQSLERLEFRNNRLDMLWRDGDTRYVNYFKNLLNLTVLDISQNNLNFIPPEV
FSGLPDKLSELYLKNNQLKDESFNWEKLQLLQSLQVLDLSGNSLTSVPPMLSICSKSLKK
LLLHKNQILKLTPDFLKDAHKLEYLDLSYNHIQHIEKSSFPDDVVDKMQKLLLHNNRFLC
TCNATWFITWLNRTTVTIPRLATDVTCASPGAQRGQSVISVDLLACQHSYLSITLYTLMT
SLVLSFLTLSISSHLFLWDVWYIYHFCRAKFKGYRRLRSQSSAYDAFVMYDKEDSAVTEW
VMKEMCAHLEERGDRRLTLCLEERDWIPGCPLIDNLSQSIHNSKRTVFILTSSYLKSGNF
KTAFYMANQRLMDEKNDVIVLIFLEKVACNSKYLRLRKRLFKRSVLEWPTNPQAQLYFWF
SLRSVLATESHKQYNNLFKETL
Download sequence
Identical sequences G3NIU9
ENSGACP00000005259 ENSGACP00000005259 69293.ENSGACP00000005259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]