SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000006137 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000006137
Domain Number 1 Region: 107-353
Classification Level Classification E-value
Superfamily DNase I-like 2.88e-32
Family DNase I-like 0.04
Further Details:      
 
Domain Number 2 Region: 19-59
Classification Level Classification E-value
Superfamily UBA-like 0.00000024
Family TAP-C domain-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000006137   Gene: ENSGACG00000004644   Transcript: ENSGACT00000006154
Sequence length 355
Comment pep:known_by_projection group:BROADS1:groupX:7113611:7115820:-1 gene:ENSGACG00000004644 transcript:ENSGACT00000006154 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASNGASDSDKPSVSNVERSRSRLCDEFASLTGSDSGVAQCYLAEHEWEMERALNSFFEA
DLEKVFEDDIPNSETSPPKKKQKVDIDLTGDSPASTRKPSDEDDNKLSLISWNVDGLDTD
NLGERARGLCSFLVLYTPDVVFLQELIPPYVQYLKKRAVSYLIIEGGEDGYFTGMMLKKT
RVRFLESEIVSYPTTQMMRNLLVAQVTFKDQKLCLMTSHLESCKGQAEERMKQLRVVTHR
MREAPDDVTVLFGGDTNLRDAEVAKVGLPSGVCDVWERLGKQEHCRYTWDTKANNNKKVP
YISRCRFDRVYLRPAAKDGVPRLAPDHMALVGLEKLDCGRYTSDHWGIYCSFSSA
Download sequence
Identical sequences G3NLC4
69293.ENSGACP00000006137 ENSGACP00000006137 ENSGACP00000006137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]