SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000006325 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000006325
Domain Number 1 Region: 1-452
Classification Level Classification E-value
Superfamily Sema domain 1.05e-122
Family Sema domain 0.0000304
Further Details:      
 
Domain Number 2 Region: 1304-1433,1654-1836
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.23e-49
Family p120GAP domain-like 0.025
Further Details:      
 
Domain Number 3 Region: 813-912
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000237
Family Other IPT/TIG domains 0.0086
Further Details:      
 
Domain Number 4 Region: 997-1100
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000336
Family E-set domains of sugar-utilizing enzymes 0.086
Further Details:      
 
Domain Number 5 Region: 910-998
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000433
Family Other IPT/TIG domains 0.041
Further Details:      
 
Domain Number 6 Region: 455-506
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000663
Family Plexin repeat 0.0019
Further Details:      
 
Domain Number 7 Region: 756-790
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000051
Family Plexin repeat 0.0022
Further Details:      
 
Domain Number 8 Region: 1116-1188
Classification Level Classification E-value
Superfamily E set domains 0.0000482
Family E-set domains of sugar-utilizing enzymes 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000006325   Gene: ENSGACG00000004780   Transcript: ENSGACT00000006342
Sequence length 1843
Comment pep:known_by_projection group:BROADS1:groupXII:4743053:4896679:1 gene:ENSGACG00000004780 transcript:ENSGACT00000006342 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTHLVVHNKTGEVYLGGVNWIYKLSKNLTKLRSHVTGPVTDNPRCYPPPGVQSCPHELVQ
TSNVNKLLLLDAAHNRLIACGSTSQGICQFLRLDDLFKLGEPHHRKEHYLSSVAEAGTMS
GVVISPDLFGGGGKLFVGTPIDGKSEYFPTLSSRKLMSNEENADMFSFVYQDEFVSSQLK
IPSDTLSKFPAFDIYYIYGFNSEQFVYYLTLQLDTQLTSPDASSEQFFTSKIVRLCVDDP
KFYSYVEFPIGCTKDGVEYRLVQDAYSLGIQEHEEVLFTVFAQGQKNRAKPPKESALCLF
TMRRIKERIKERIQSCYRGEGKLSLPWLLNKELACINSPLQIDDNFCGQDFNQPLGGTTA
IEGIPLYVDKDDGMTSVTAYDYRGHTVAFTGTRGGRIKKVGVDLGAPTQFLLQYYENVVV
SDGSPILRDMLFSPDHQNLYALTDKQVTRVPVESCEQYSNCGACLGSGDPHCGWCVLHNV
CARKDRCERAEEPQRFTTRAEQCVRLSVQPNTVSVTMSEVQLSLQTQNVPSLSAGVNCSF
EDYVETEGRIYGGRIFCLSPSTKAVSPITRDQGDQRVIKLYLKSKETGKKFASVDFVFYN
CSVHQSCLSCVNGNFPCHWCKYRHMCTQDASDCSFQEGRVNTSEECPQILPSTQIYMPAG
VLRPITLLAQNLPQPQSGQRNYECIFHIQGNTHSVPALRFNSTSIQCQKTTYSSVGSECS
TLKPPDTSPVWMNGNILIDFSRTHRAHLYKCRALRDSCGMCLKADPRFECGWCVQDRKCS
LRQECNGGGNAHLPLQPQEGGGWMHATSGNSRCTHPKITKLFPETGPRQGGTRVTILGEN
LGLQFRDIQMGVRLGKVPCVPIEEEYISAERIVCLLNDATSYRVQEAQVEVCVRDCVNDY
RALSPRPFTFVTPFFSRIQPSQGPISGGTRVTIEGSYLNAGSYVSVSIGPQPCYFKKRFA
REIVCVTPAGLTAGTASVLVDIDDAELRNPEVKFNYTEDPTVLRIEPDWSIASGGTLLTV
SGTNLATIREPKIRAKYGQAESFHNCTVYNNSVMVCLAPSVADSELAFSESGTGPDEIGF
YMDNVNALVVVNETFSYYPDPVFEPLSASGVLELKPTSPLILKGRNLIPAAPGNSRLNYT
VLIGETPCVLTLSESQLLCEWPNLTGQHKVTIRAGGFEYSPGTLHIYSDSLLTLPAIIGI
GGGGGLLLLVIIAVLIAYKRKSRDADRTLKRLQLQMDNLESRVALECKEAFAELQTDIHE
LTQELDGAGIPFLDYRTYAMRVLFPGIEDHPVLKEMEVQANVEKALTLFGQLLTKKHFLL
TFIRTLEAQRSFSMRDRGNVASLIMTALQGEMEYATGVLKQLLSDLIDRNLESKNHPKLL
LRRTESVAEKMLTNWFTFLLYKFLKECAGEPLFMLYCAIKQQMEKGPIDAITGEARYSLS
EDKLIRQQIDYKTLNHCVHFPFLLFPTVCMFSSPQTLHCVNPENENAQEVTVKCLNCDTI
TQVKEKLLDAVYKGSPYSQRPKASDMDLEWRQGRMARIILQDEDVTTKIDNDWKRLNTLA
HYQVTDGSVIALVPKQNSAYNISNSSTFTKSLSRYVFPALESMLRTASSPDSLRSRTPMI
TPDLESGTKLWHLVKNHDHSDQREGDRGSKMVSEIYLTRLLATKGTLQKFVDDLFETIFS
TAHRGSALPLAIKYMFDFLDEQADKHSITDYDVRHTWKSNCLPLRFWVNVIKNPQFVFDI
QKNSISDACLSVVAQTFMDSCSTSEHKLGKDSPSNKLLYAKDIPNYKNWVERYYSDISRM
PAISDQDMSAYLAEQSRLHLSQFNSMSALHEIYSYIIKYKDEV
Download sequence
Identical sequences G3NLW2
ENSGACP00000006325 ENSGACP00000006325 69293.ENSGACP00000006325

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]