SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000006955 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000006955
Domain Number 1 Region: 5-161
Classification Level Classification E-value
Superfamily RUN domain-like 6.02e-31
Family RUN domain 0.0013
Further Details:      
 
Domain Number 2 Region: 679-841
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000129
Family Pleckstrin-homology domain (PH domain) 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000006955   Gene: ENSGACG00000005254   Transcript: ENSGACT00000006973
Sequence length 990
Comment pep:known_by_projection group:BROADS1:groupXII:5771224:5781330:-1 gene:ENSGACG00000005254 transcript:ENSGACT00000006973 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQLKVKDRILENISLSVKKLQSYFAACEDETPAIRNHDRVLQRLCEHLDHALLYGLQDI
SSGYWVLVLHFTRREAVRQIDELQHIATNLGRSRAWLYLALSESSLESYLRLFQENQALL
QKYYFKNALVCSHDHLTLFLTLVSGLEFIRFDLELDVPYLDVAPYMPEYYKPQNLLDFEE
RLPSSDSLSLHSFTSLTSTNLEWDDSAIAPSSEDYDFGDIFPVLRSLPSADWEEGDLTDQ
ASCPRSSGSDPQTARAAAPLAPHSPTHRHNPFNEDSDTNTSADVTPVHLASCYSAESACN
ELEVIRMARRRRTSKKRRGKGSTDSISSLHNSVSSEHLETDNRRMSSEDVDSLNGAVIQP
DAEGELGRSRVGSEVVEEGEEEEEGAEGLLRLPEMTDTSMEAVGQPLREVMDRLNGALEI
EEVWERRGEGEKRGSDCNRGPEPPTRQPFREESEGEPPDPAAGETSVFLQAAAEPAELRC
FTPNSSDSPPSGGRYDDPTEHSRSQTLSGGLEDEGDAEASAGQKAEMKAGEVDAEEGEKT
VHNEFTEEAERSHPAEFKVDNNHLLLLMIHVFRENEEQLFKMVRMSTGHMEGDLQPLYLL
LTDCYIYLLRKGAAEKPYTVEDAISYNELDYLSVGLDQQTVAVVCTNRRRKFLLDTADAS
LTLWFLSVLESAMVKGCREPPYPSVLTDATMEKLSLTKFVSQESQCEVCEVSIQLYSLVH
WEDPMDMALSPQGGPPISGLSASTKEGALQYRAGSTYLGREVWKSCYLVLSKGILYLYAE
RTDVTPVLSVTMGGGHCGGCRRSNSTERPHAFHVILTERPALELCANNEQDMAEWMLLLC
QSVSKGVIPQGVAPAPCIPCCLVMTDRKLLTCHQDCQTSFFRSLGSADICDVTSVSVEAN
KEYCVIEFATDRSQFLPPWVLYFSGCGERDRLLKALDDTWKAVYQVDLPHREVLDVSVQK
RCGEALALMTSAWQRADSLARGRAQREPWC
Download sequence
Identical sequences G3NNP1
69293.ENSGACP00000006955 ENSGACP00000006955 ENSGACP00000006955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]