SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

  Home > Genomes > Gasterosteus aculeatus 76_1 > ENSGACP00000006985

Domain assignment for ENSGACP00000006985 from Gasterosteus aculeatus 76_1

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:  ENSGACP00000006985
Domain Number 1 Region: 193-442
Classification Level Classification E-value
Superfamily YWTD domain 1.19e-43
Family YWTD domain 0.0000208
Further Details:      
 
Domain Number 2 Region: 592-630
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000144
Family LDL receptor-like module 0.00061
Further Details:      
 
Domain Number 3 Region: 761-797
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000144
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 4 Region: 509-548
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000812
Family LDL receptor-like module 0.00071
Further Details:      
 
Domain Number 5 Region: 806-842
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000183
Family LDL receptor-like module 0.00081
Further Details:      
 
Domain Number 6 Region: 633-672
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000511
Family LDL receptor-like module 0.00069
Further Details:      
 
Domain Number 7 Region: 676-709
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000275
Family LDL receptor-like module 0.0032
Further Details:      
 
Domain Number 8 Region: 712-748
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000654
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 9 Region: 550-583
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000445
Family LDL receptor-like module 0.0029
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000006985
Domain Number - Region: 983-1029
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00365
Family Fibronectin type III 0.0097
Further Details:      
 
Domain Number - Region: 919-936
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0589
Family LDL receptor-like module 0.0062
Further Details:      
 
Domain Number - Region: 453-482
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0778
Family EGF-type module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000006985   Gene: ENSGACG00000005271   Transcript: ENSGACT00000007003
Sequence length 1031
Comment pep:known_by_projection group:BROADS1:groupI:1076088:1085084:1 gene:ENSGACG00000005271 transcript:ENSGACT00000007003 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence 
WFDFRFSDRAVYVYQLLTEPGEKSTIFTIFGSYADQRHGWLILQVNTSDVLGVPGVPCSD
ADYKRWSPSDEHGNECLLGREVTFKRRAPHATCFNGEDFDRPVSVANCSCTRQDYECDYG
FKPSEDLSLQVCVPDPEFSGDLYAPPVPCPVGTTYRRSKGYRRVPGDSCSGGDVASRLDG
EMLPCPVGESNEFILYAVRNSIHRYDLATGADQALPLAGLREAVALDFDYDRNCLYWADI
SLDTIQRLCLNGSTGQEVVVRKDLQNVEALTFDPISRLLYWVDAGAQKIEVSNPDGDMRH
TLLNSSILEHPRALVLLPARSLMFWTDWGDRAAGVYRSYMDGTNASCVVSEGVRWPNGIA
ADERWLYWTEAYSDRIERADFTGGARSVLVEGLPHPYAIAVFKNDLYWDDWSRMGIFKAP
KAGSQSNELIVGRLTGVMDLKIFYKGKNRGERHNACADQPCSLLCLPQPGHRHTCVCPDG
APTVATPTGELQCLCPPGYLLQNGTCVKTEHSCLPNQYRCSNGRCISSIWKCDSDNDCGD
MSDEQECPTTTCDPSNQFRCVVSGSCILLAFKCDHEDDCGDNSSHLKTSSESHQCGPGEF
TCARGVCIREAWRCDGDNDCRDWSDEANCTVGRHTCEASSFQCHTGHCIPQRWMCDGDDD
CQDDSDEDPRYCEGTRCNGFLCSNHTCLPATAHCNGMRECPDGADENNCDPLCTRYMEFV
CKNRAQCLFQSLVCDGIKHCEDGSDEDADYAGCATPSEFGKVCDSYTFQCANGVCVSLEW
KCDGMDDCGDYSDEANCAAPTEVPGCSRYFQYECSNGRCIPTWWKCDGENDCGDWSDEAQ
CTGTGRPGLPHCFPLHYGIRLATDVTRTYICYNEIYIRSSEVILPVMTPTHKVITDNALG
FLFFLLGPRKHHIPRSTTFRDCSDHSDEDNCTLCISTAANALKYLMHEIQCCHLVAAGSG
LFVCEMKLNRGPPPKDTLAYKVQNLQWTPDFLGAITLTWSRPKSLPVDSCYFLVYYRLVG
TQQWTVMDTHS
Download sequence
Identical sequences G3NNS1
ENSGACP00000006985 ENSGACP00000006985 69293.ENSGACP00000006985

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]
Please cite: Gough, J., Karplus, K., Hughey, R. and Chothia, C. (2001). "Assignment of Homology to Genome Sequences using a Library of Hidden Markov Models that Represent all Proteins of Known Structure." J. Mol. Biol., 313(4), 903-919.

Please send feedback, comments or questions to superfamily@cs.bris.ac.uk or use the feedback form.

© Copyright 2013 The SUPERFAMILY authors and Julian Gough.