SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000007387 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000007387
Domain Number 1 Region: 25-189
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.48e-31
Family Laminin G-like module 0.0045
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000007387
Domain Number - Region: 204-235
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000322
Family EGF-type module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000007387   Gene: ENSGACG00000005573   Transcript: ENSGACT00000007406
Sequence length 236
Comment pep:known_by_projection group:BROADS1:groupVI:6775232:6776890:-1 gene:ENSGACG00000005573 transcript:ENSGACT00000007406 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLMLLLLFFYSFSVCSFFLSSKIGTCLEFTGAEGQWARFPVWNACCESEMSFSMKTKSSN
GLLVYFDDEGFCDFLELLILNGKLSLRFSIFCAEPATVVSDTAVNDSQWHAVTIRRNFKN
TTLKVDNEKKWVEVKSKRRDMTVFSHLFVGGIPPELRSVALRLTSDAVKDQLPFTGWITD
IKVNNTEPVMIDGEGVLEDLCGSANMCLNGGVCSIINNEPTCNCSRTGFQGKDCSE
Download sequence
Identical sequences G3NPX2
ENSGACP00000007387

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]