SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000008555 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGACP00000008555
Domain Number - Region: 18-150
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 0.000405
Family Toll/Interleukin receptor TIR domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000008555   Gene: ENSGACG00000006471   Transcript: ENSGACT00000008574
Sequence length 184
Comment pep:known_by_projection group:BROADS1:groupXVIII:4563033:4564849:1 gene:ENSGACG00000006471 transcript:ENSGACT00000008574 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SIQACPGPATGEIRKTISLSEEYRNVFITYSVDTAEEIIPFTKFLTDQGFKPAIDIFDNP
IRRMGINKWMDRFLNDKSVLIIVVISPKYKEDVEGDGDDDHGLHTKYIHNQIQNEFIQQG
CLNFRLVPVLFPNASKRHVPNWLQSTRIYRWPWDTQDLLLRLVREERYIIPQRGADLTIT
VRPL
Download sequence
Identical sequences G3NT87
ENSGACP00000008555 ENSGACP00000008555 69293.ENSGACP00000008555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]