SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000008560 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000008560
Domain Number 1 Region: 139-384
Classification Level Classification E-value
Superfamily vWA-like 2.89e-65
Family Integrin A (or I) domain 0.000000852
Further Details:      
 
Domain Number 2 Region: 403-475
Classification Level Classification E-value
Superfamily Integrin domains 1.52e-17
Family Integrin domains 0.0015
Further Details:      
 
Domain Number 3 Region: 45-97
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000246
Family Plexin repeat 0.0013
Further Details:      
 
Domain Number 4 Region: 589-629
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000893
Family Integrin beta EGF-like domains 0.0025
Further Details:      
 
Domain Number 5 Region: 547-585
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000001
Family Integrin beta EGF-like domains 0.02
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000008560
Domain Number - Region: 509-547
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00642
Family Integrin beta EGF-like domains 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000008560   Gene: ENSGACG00000006439   Transcript: ENSGACT00000008579
Sequence length 768
Comment pep:known_by_projection group:BROADS1:groupX:9188960:9199628:1 gene:ENSGACG00000006439 transcript:ENSGACT00000008579 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTDPLLNARPADRCRMASRERLPAALRRHECAADLHTGARARCDSACWSPGVTSCAECLG
RGPQCAWCFKKDFLVPSQRCDSPVKLLRRGCDREFMEQSEIKVEVDATASSTQVSPQDIS
ITLRPGSEASAIVAVKQLERYPVDLYCLVDVSASMQENLDHLKTVGVALSFRMAEHSSDL
WLGFGSFVDKPVSPYINVHSSKIDNPCSSDYEIRCRPAHGFHHVLSMTSNMSEFTRVIKR
QRISGNMDTPEGGLDAMLQAAVCQRSVGWRPDAKRLLLLMTDQPSHLALDSRLAGIVTPH
DGLCHLENNVYTGSTKMDHPSVGLLSDKLLENHMHSIFAVEKQQYQWYEELVRLLPGSYL
GKLGFFQAPNLIELVVDAYKTLLSEVAVSVSVEDKAASRYWVSVSPLCPDGSTVKDQSCS
GVMPGQTVYFNITIGMRSCPGNGEDEDVTVMVRPVGYNESTVIKVHSKCTCSCGATRRCY
EESQCGGSSGQEQELDQGLINDADGESSWNCRRDGSDVDCSGRGACECGRCVCDQTRLGA
VYGKHCEIDDFSCPYRGGLLCGGRGTCVSGECVCEDDWTGDSCGCPVSTATCQSTKGLLC
GGRGRCVCGRCVCDDPRRSGDFCERCPACQNSCQSYWKCVDCHLSHGLAQKEAGHCNNTC
APLVGYVDVVSECGNNSRLLGTFLSVCALTVLCGLVVVAVSRLLLQKRGLSPGGTAAEGP
YHCPGKDLSFIPTTNEKTVTYRRDCPPDRPLEMHIQVPKMPLCDPWQC
Download sequence
Identical sequences G3NT92
69293.ENSGACP00000008560 ENSGACP00000008560 ENSGACP00000008560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]