SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000008578 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000008578
Domain Number 1 Region: 133-380
Classification Level Classification E-value
Superfamily vWA-like 7.11e-83
Family Integrin A (or I) domain 0.00000000523
Further Details:      
 
Domain Number 2 Region: 376-465
Classification Level Classification E-value
Superfamily Integrin domains 3.98e-30
Family Integrin domains 0.000011
Further Details:      
 
Domain Number 3 Region: 639-722
Classification Level Classification E-value
Superfamily Integrin beta tail domain 7.98e-22
Family Integrin beta tail domain 0.0000384
Further Details:      
 
Domain Number 4 Region: 26-83
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000785
Family Plexin repeat 0.00035
Further Details:      
 
Domain Number 5 Region: 553-591
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000159
Family Integrin beta EGF-like domains 0.008
Further Details:      
 
Domain Number 6 Region: 595-636
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000243
Family Integrin beta EGF-like domains 0.001
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000008578
Domain Number - Region: 522-553
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00586
Family Integrin beta EGF-like domains 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000008578   Gene: ENSGACG00000006460   Transcript: ENSGACT00000008597
Sequence length 795
Comment pep:known_by_projection group:BROADS1:groupV:8313286:8325312:-1 gene:ENSGACG00000006460 transcript:ENSGACT00000008597 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FPRPPHLLFTGITGVCAIELLVSGLNVCTSRGASTCKQCLAVHPSCAWCFQEDFGQGAAS
SSRCDLKSNLAAAGCALSALESPASKLQVIEDRPLSNKAAGATQDVTQIQPQKLQITLRP
DDAKRFTVKVRQVEDYPVDLYYLMDLSYSMNDDLFRLRTLGKGLAEAMNRTTSNLRMGFG
AFVDKPISPYMYISPKQAVKNPCYSINTTCLPQFGYKHVLTLTEEVGRFTEEVKKQMVSR
NRDAPEGGFDAIIQAAVCKEEIGWRPGASHLLIFTSDAKTHMALDGRLAGIVRPNDGKCH
LNSDNMYSMSTTMDYPSLALITEKTSENNINLIFAVTNPVVPLYQNYSELIPGTTVGTLS
NDSGNVIQLILKAYAKIRSKVELELQGVPEELSLSFNATCLNGEVIPGLKSCSGLKIGDT
VSFSVEARARGCPKEKKKSFIIKPVGFKDSLSITVDFECDCKCQAEAQPDSPACNHGNGT
YECGICLCHPGRLGPHCECAEGDYDPTEQDRCSGPAGSGGPQSAICSGRGDCVCGQCVCH
GSDFGKVWGKLCECDDFNCLRYKGELCSGHGVCNCGFCQCAPDWQGDNCNCSRRTDTCMS
HLGLLCSGRGQCACGACECTQPGAYGATCDKCPTCPDACTMKKRECVECKHFKRGTLFDG
NTCSRICKDEIVLVDKIVLHDTNAVNCTYKDEDDCVERFQYYEDTSGKSILFVVKEPDCP
KGPDILVLLLSVAGAILFLGLAALLIWKLLVTIHDRREFAKFEEERARAKWDTGHNPLYK
GATSTFTNITYRGKE
Download sequence
Identical sequences G3NTB0
69293.ENSGACP00000008578 ENSGACP00000008578 ENSGACP00000008578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]