SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000009061 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000009061
Domain Number 1 Region: 376-637
Classification Level Classification E-value
Superfamily YWTD domain 7.98e-58
Family YWTD domain 0.0000000376
Further Details:      
 
Domain Number 2 Region: 259-371,642-681
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000785
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 3 Region: 171-209
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000851
Family LDL receptor-like module 0.00057
Further Details:      
 
Domain Number 4 Region: 207-248
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000785
Family LDL receptor-like module 0.00033
Further Details:      
 
Domain Number 5 Region: 3-40
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000131
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 6 Region: 121-159
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000825
Family LDL receptor-like module 0.00068
Further Details:      
 
Domain Number 7 Region: 86-122
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000103
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 8 Region: 43-81
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000628
Family LDL receptor-like module 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000009061   Gene: ENSGACG00000006827   Transcript: ENSGACT00000009081
Sequence length 785
Comment pep:known_by_projection group:BROADS1:groupVIII:7401543:7458423:1 gene:ENSGACG00000006827 transcript:ENSGACT00000009081 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KKTCATTDFACKNGQCVPGRWRCDGEPECADGSDEADAICRRQTCSPEKFDCGGAASKCV
SLSWRCDGERDCENGADEDQCAADAQACPSKDFQCLNGKCVAPIFVCDGDDDCGDASDEV
KCSAPTCGQHEFRCNDSECIPALWSCDGDPDCKDKSDESMERCSRRTEPQKPRCPVGEFL
CGSGECVHMNWKCDGDADCKDKSDEANCPLLTCRPDEFQCGDGSCIHGTKQCNKVHDCPD
YSDEAGCVNVTKCDGSRKFRCKNGECIDRSKVCDNVKDCKDWSDEPMKECGLNECVDNNG
GCSHICKDRRIGYECDCPSGYRLLDKKTCGDINECENPDACSQICINYKGDYKCECYEGY
EMDPASKTCKAVGKSPYLMFTNRHEIRRIDLLKSEYTQVVPTLKNAVALDVDVSTNKMFW
CDLYHRKIYSAYINKASDSSQHLTLIDSLLSPEGLAVDWVHKNIYWTDSGNKSISVATGD
GRKRKVLIATELSEPRAIAVDPHQGFMYWSDWGGQAKIEKSGMNGVDRQVLVSEHIEWPN
GITLDLSNRRLYWVDSKLHLLSSVDLNGDNRKVLLSSQQHLGHPFALSVFEDRVYWTDLE
DEAIYSANRLTGHDVAKVAEHLNNPLDLVVFHEQRQPKAPDTCNMGSLPNGGCEYLCLKA
PQITDHSPKYTCACPDDMELGPDMRRCAMGNNITVAVLGIVIPIVIVSSLFPILATVVIG
LLCTGGYLVWRNWRRKNTKSMNFDNPVYRKTTEDDDDEIHIGRHSESIGHVYPAVSGSHS
QPFIA
Download sequence
Identical sequences G3NUP2
ENSGACP00000009061

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]