SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000009126 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000009126
Domain Number 1 Region: 3198-3463
Classification Level Classification E-value
Superfamily YWTD domain 7.46e-51
Family YWTD domain 0.00000302
Further Details:      
 
Domain Number 2 Region: 1457-1699
Classification Level Classification E-value
Superfamily YWTD domain 7.98e-49
Family YWTD domain 0.00000526
Further Details:      
 
Domain Number 3 Region: 391-654
Classification Level Classification E-value
Superfamily YWTD domain 5.89e-42
Family YWTD domain 0.0000154
Further Details:      
 
Domain Number 4 Region: 2388-2643
Classification Level Classification E-value
Superfamily YWTD domain 2.49e-38
Family YWTD domain 0.0000063
Further Details:      
 
Domain Number 5 Region: 4060-4329
Classification Level Classification E-value
Superfamily YWTD domain 9.42e-37
Family YWTD domain 0.0000239
Further Details:      
 
Domain Number 6 Region: 2068-2335
Classification Level Classification E-value
Superfamily YWTD domain 1.31e-34
Family YWTD domain 0.0000648
Further Details:      
 
Domain Number 7 Region: 1745-2010
Classification Level Classification E-value
Superfamily YWTD domain 4.19e-34
Family YWTD domain 0.00012
Further Details:      
 
Domain Number 8 Region: 733-962
Classification Level Classification E-value
Superfamily YWTD domain 3.53e-32
Family YWTD domain 0.0000544
Further Details:      
 
Domain Number 9 Region: 264-279,314-382,655-703
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.34e-18
Family Growth factor receptor domain 0.021
Further Details:      
 
Domain Number 10 Region: 1065-1102
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000013
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 11 Region: 3143-3191
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000153
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 12 Region: 2984-3026
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000017
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 13 Region: 1266-1307
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000017
Family LDL receptor-like module 0.00095
Further Details:      
 
Domain Number 14 Region: 27-63
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000393
Family LDL receptor-like module 0.00077
Further Details:      
 
Domain Number 15 Region: 2903-2938
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000393
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 16 Region: 178-219
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000458
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 17 Region: 218-257
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000497
Family LDL receptor-like module 0.00059
Further Details:      
 
Domain Number 18 Region: 1351-1429,1689-1742
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000596
Family Growth factor receptor domain 0.021
Further Details:      
 
Domain Number 19 Region: 1145-1184
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000785
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 20 Region: 3025-3066
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000812
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 21 Region: 3627-3669
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000916
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 22 Region: 3805-3843
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000196
Family LDL receptor-like module 0.00098
Further Details:      
 
Domain Number 23 Region: 2734-2775
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000275
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 24 Region: 3586-3628
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000576
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 25 Region: 2698-2735
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000628
Family LDL receptor-like module 0.00061
Further Details:      
 
Domain Number 26 Region: 102-142
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000995
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 27 Region: 3069-3108
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000119
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 28 Region: 2019-2059,2344-2381,2642-2706
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000144
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 29 Region: 2856-2894
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000314
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 30 Region: 3718-3754
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000034
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 31 Region: 3547-3587
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000628
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 32 Region: 1230-1266
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000128
Family LDL receptor-like module 0.00077
Further Details:      
 
Domain Number 33 Region: 3110-3156
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000141
Family EGF-type module 0.023
Further Details:      
 
Domain Number 34 Region: 3509-3545
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000144
Family LDL receptor-like module 0.00087
Further Details:      
 
Domain Number 35 Region: 66-101
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000183
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 36 Region: 3927-3963
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000196
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 37 Region: 1187-1225
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000034
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 38 Region: 3883-3921
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000144
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 39 Region: 2777-2817
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000157
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 40 Region: 147-180
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000196
Family LDL receptor-like module 0.0025
Further Details:      
 
Domain Number 41 Region: 2820-2858
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000275
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 42 Region: 1023-1059
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000471
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 43 Region: 3681-3714
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000589
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 44 Region: 4002-4047
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000628
Family EGF-type module 0.012
Further Details:      
 
Domain Number 45 Region: 1310-1347
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000707
Family LDL receptor-like module 0.0026
Further Details:      
 
Domain Number 46 Region: 2940-2985
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000144
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 47 Region: 4386-4420
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000343
Family EGF-type module 0.093
Further Details:      
 
Domain Number 48 Region: 3970-4009
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000839
Family EGF-type module 0.016
Further Details:      
 
Domain Number 49 Region: 977-1017
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000287
Family EGF-type module 0.0087
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000009126
Domain Number - Region: 4339-4366
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0398
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000009126   Gene: ENSGACG00000006865   Transcript: ENSGACT00000009146
Sequence length 4472
Comment pep:known_by_projection group:BROADS1:groupV:9162963:9191164:1 gene:ENSGACG00000006865 transcript:ENSGACT00000009146 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SDRKYVSLGCFRLKMMIVYLGCAYAGSCESGEFQCSSGQCINKAWRCDGTKDCTDDSDEL
NCPTSTCTSQEFKCVTSGECISLGFVCDGEDDCVDGSDEKRTCGGRTCSPDQYTCQEGQC
VPSKYRCDHVKDCVDNSDENNCNYPRCTEKTCANGACYNHSQHCNGLQDCRDGSDEFNCT
TQHCPIHQYQCANGYCIPHSFVCDHWNDCGDNSDEEGCAYRSCSGGEFTCSSGRCIPQRW
VCDKFNDCGDYSDERGCDSNSRDCYPGEWGCPGSTVCIPVGKVCDDQPDCPGGADETNST
AQKTCSLEQCAALSCEFLCHPSPEGGACYCPDGFTVANDSRSCVDYNDCEIWGVCDQLCE
DRPGTHRCSCADGYFLEQGHVCKANVSAGLPQLIFTNGGDVMMADIHGRFVRTLVPSQGK
GFSVGVAYHWHSNTVFWSDTYTKKVYSANYNGGDIKEVLTAAVQSVQNLAVDWINFKLYV
LEATMERIDVCDFGGENRVTLVAENLQTPHGLALDPTVGYMFFTDMGDAGEHMKLERAFM
DGSNRVELVKSRLGTPTGITLDIVTKRVYWSDSHFDTVETVTYSGLDRKIVLNGGTQAPY
PFGIAVFENHVFFTDWTKMGVVRANRFNGSNPALLYRTAKRPGHVVVSHAALQPVVMNPC
GKHNGGCQQICVLSHRTDNDGLGFRCKCRHGYDLQTDRRTCFKVKDYLLLATSLGVRGIP
LNMSLQEDITLPLSGLGTSFSGSAVEFDGNEEALFYNDRSRGLVYKSNLNGTVQQILTGY
RVGTIDAMAYDWTSKVLFWTTSTYKTVVAFRVPDKSRRDIVTGLRNPKGIAVHPSAGFLF
WSDWYRPAVIMRGFTDGSNAVPLVNTTLGWPYGLSVDFVTDRLYWVDSQLDQIGHISIQG
HDRQTFSNIGQITQPYSLTIYSDYLYVSDTRTRAVFEMRKRDGGGNVMIRQGITGILNVK
AYTADLHSAFTSRCNVVSNGLCSHFCFPTPSFSRVCGCPYGMKLQANQRDCIKDDSVPPP
PDNNCGDFSFECDEGHCRPNSYRCDGVADCIDQTDEANCTDTGATCSPRAFTCNNKHCIL
SNWRCDGVDDCGDGSDELNCPTSLPSTCAAGYFTCDNNRCVSERTAVSVWGRSNYGSSES
FKQNSTITTCPPAYFLCPDHRCIHNSYLCDGDQDCLDGSDEKNCEFACASYEFACASGDQ
CVTSRYRCDGVFDCRDHSDERDCPTRVPGLCHKNEFQCQTDGFCVPDEWECDGHPDCEDG
SDEHNSCPPVTCRADYFQCTNKLCVPSDWLCDGENDCRDMSDEQNCPTPPFSCPSGQWQC
PTDLLCIDLDKVCNGQRDCPNGADESPICNQDDCVLNNGGCSNGCVQGPFGAQCTCPSGF
QLLNDSKTCEDIDECLIPGFCSQQCFNERGSFRCYCSHGYLLGADGRTCKAADPLAAVLL
VAKRSQIVADRINRRPPLIVPVISGSGIVSVDFDRVTSRIYWADASQKKIWSAYQNGTDR
REVFSSGLMVPESIAVDWTGRNLYWTDSVLENIEVSTLDGRFRKVLLTKNVTSPRGLVLD
PRNYTNLMFWSDWGQNPRIERASMDGAMRRVIVSTKLYWPNGLALDYTTRRLYFADAYLK
YIDYCDYDGNNRHQVMASDLVLQHPHGMTIFEDDIYWSERYTSKVMRTNKFHGGNITTLM
NDVFQPMGIVMDHPIKQPTAIDPCREHLCSQLCLLSGLRPRYYTCHCQSGWKLGDDKRTC
VKDEIPFLMVVRDSVIFGIPLDPTDPSNNAMAPVSGISQGKDIDFDDQEQLLYWVQSTGS
IWQVKTSGANRSEFAPAAFIGSPSGLAFDWISRLMFYTNPTGKAIEVIRVDGDQHYRKTL
ITSTGKPEGTGEPLGIALDPARGKLFWTDKGADNGVPPKVGSADMDGGNLTNLYTGNLAN
IGFIAADVSTMKLYWGVSGSGVIESGTMDGVTRVIVVRGLSHPWGLTIHQNHLYYTDLDY
EVIERVDKHNGANMSVMRSGMSGLRALKVHARDNSAGTTNACSSNNGGCPHLCLPKPGNQ
KTCACTTGFNPTQDGSRCEQYESLAIVSATNYIRGFHINSSDHSEAMVPVGGSMSASCNL
DLHVESGFVYWADNSTSPPFRGIFRAKTDGGHYSTVLNSGVGRGGIPGLAVDWVAGNVYF
TNAFESETFLEVLSINTTYRMILLKSSQDRPRDLAVSPKLRYLFWTDGGQTPKIERALLD
GTNRTVLASESLASPRGLTIDYTNDFLYWTDDVLDMISRMATDGTQRQIVRFGSRYPSPV
GMAIFGNYMLWVDTKLGKLLQASKDPANADQPEVIRDNLEGLMDVSVFDAHVQPTSANQV
GFNPCQEDNGRCQQLCFAMPGQEQPKCGCAHGSLLSNGVTCGYGQEEFLVFTTDYTLNSL
RLDPLDHSAPYPVVNLGYNLMALDYDFKEKRIFFTQYLGIGGSRIGYVTTTSITTAPVLL
ATDLDDPEGLAYDWVNKRLYFTDYYSRNVQSIGADGANRSIVAHANRPRGIVVDPCYGYL
YWTDWGFPAQIERATLGGKFRTPIINSSLTTPNGLTLDYEERMLYWADASLNKIERATLT
GANRQVILLGVQYPYAMTVFQQDIFWTDWTEKAVFRAGKVDGSGVTVLAQDLQYRPNDIH
VYAASKQESCSSSCQQFNGGCSNVCVPGPLGPECQCPHEGKWYLANNGKDCIEDTGKRCQ
PEQFSCLNGNCISARWKCDGHDDCQDNSDELQRVCAFHTCSATDFTCDNGRCVLLSYVCD
YVDDCGDNSDERGCPFPTCNPATEFTCANGRCISAALVCDGHNDCRENTTSDEINCPDRS
CPADQVKCERNNICIYPESLCDGYNNCGDNSDENPLFCAGRTCSTDQFRCDEGKCIPDSW
VCDSIQDCSDATDEPLSCKDQIRTCGPSQFTCTNGNCIPQSLVCDGNNDCWDTSDEAPEL
QCGQQTCSSDQFTCPTWFPSYPRCVPLSFVCDGEKNCANAADELHNCPNRTCHMNEFACS
NGICILLPYHCDRVNDCGDGSDELHCAYDTCSSHQFTCGNGACIPASFTCDGQSDCTDGS
DEAESLCAPPRPTCAPQQFMCKSGDCIDVGKVCNGQKDCGDNSDEKGCGVNECLNPSVHK
CAQLCTDTLTGYYCSCQPGYRLMPDGKACEDLDECSSTPAVCSQICENTVGSFHCKCAPG
YVREPDGRTCRQNSGVAPYLLYSNRYYIRNLTTDGSLLSIVLQGLSNVVALDFDDYEKRL
YWLDAGAGRIERMRFDGTDRETLADDDVFGAEGLALDWVGRKLYWLDGYYGSVHVMELDG
RYQKRLLSGEFTDGNATYPISRPRAVAVNPKYGWLYWTDWGDTAYIGRVGMDGHNVSALI
TSKLEWPSALTIDYTTNNIFFADSHLSFLDFADMNGQNRHRAIAGALPHVFAVSLFEDWV
YWTDWNTHTVEKAHKYTGEQRTVMGNNTHRPYDIRVFHPYRQPRSENPCSSHHLTCSHLC
LIAPGGEQATCQCPDNFIGLSVGFKIQCVADCSSTQFRCGDNEKCVPIWWKCDGQSDCGD
GSDEPQTCPPRYCPVGQFQCRDGNCTYPGFICDGHPDCPDSTDEDAALCSDHRCQENQFQ
CKNKKCLPVSWHCDGVSDCSDASDEDAETCSQRTCKPGEFRCGNGRCLPSGYVCDAQDDC
GDGSDEPYETCMGPDYKCDEETEFSCKTNYRCVPQWARCDGTNDCIDNSDEQGCEEVTCD
PLGDFRCENHRCVPIRWQCDGTDDCGDSSDERNCQPRPCSESEFRCDNAQCIPGELRTRP
LVSSEIPCAVSGPPSLPPGFLPELNTCRPGRFQCDSGHCIPAALQCDGRPDCQDLTDETS
CPTRYPGGRWCPQSQFQCANHLCFPSSLKAIKTCVCVLTVNVTCEMPSRFRCANGYCIYS
GLLCNQKDECGDGSDEKEELCHEPTLPPCTLEQFKCTNGQCVALPYVCDHNDNCGDRTDE
LGCNFGNERNCEEKLCQHECTNLNGTGFICSCRPGYRVNPDSTYTCLDIDECAAWGTCPQ
VCKNTKGGYDCECAPGYRKVGDGNKCEAEGATPLMLLPENIRIRRFNLQTETYHDFLLEE
ERIVALDYDWDHNHTGFSMVYFTVAGKDSEAGAIKRAYIPSADDGSNNIGAAVDLGIKYI
TRPGGVAVDWVGSNRRNLYWADSGLKRLEVAMLDGRYRKQLVKTELGQPSAVAVNPRLGM
LYWADRGDAAKIERSWLDGQERTVLVADGLGWPTGLSIDFTNGDRIYWSDSKESRIESVL
PSGGDRRTAVYIDVRNPFSVSVFEDHVYWSTQEKGEVFRQDKFGRGAKAKLLTGGPWLTQ
VSVYQQQRYNSIAMKNPCKGTCSHLCLLRPGGYTCACPQGTDFTPGSNTECDAGFDPPPT
MPPPCQCQNGGTCYFDDNEALCICSADWTGEYCQINVHNVVASSIGIAIGVTVLIVVLLV
ALVYAARKKSNLMERVWSSLPSMPSMPSMPSM
Download sequence
Identical sequences G3NUV7
ENSGACP00000009126 69293.ENSGACP00000009126 ENSGACP00000009126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]