SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000009974 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000009974
Domain Number 1 Region: 876-924
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000335
Family Laminin-type module 0.0069
Further Details:      
 
Domain Number 2 Region: 1142-1190
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000391
Family Laminin-type module 0.021
Further Details:      
 
Domain Number 3 Region: 1033-1080
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000809
Family Laminin-type module 0.0028
Further Details:      
 
Domain Number 4 Region: 397-446
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000837
Family Laminin-type module 0.018
Further Details:      
 
Domain Number 5 Region: 267-336
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000272
Family Laminin-type module 0.019
Further Details:      
 
Domain Number 6 Region: 922-972
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000391
Family Laminin-type module 0.005
Further Details:      
 
Domain Number 7 Region: 334-399
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000949
Family Laminin-type module 0.053
Further Details:      
 
Domain Number 8 Region: 1190-1237
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000109
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 9 Region: 498-537
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000151
Family Laminin-type module 0.03
Further Details:      
 
Domain Number 10 Region: 1085-1140
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000837
Family Laminin-type module 0.0061
Further Details:      
 
Domain Number 11 Region: 982-1035
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000474
Family EGF-type module 0.077
Further Details:      
 
Domain Number 12 Region: 828-869
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000642
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 13 Region: 449-489
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000698
Family Laminin-type module 0.024
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000009974
Domain Number - Region: 87-160
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00794
Family APC10-like 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000009974   Gene: ENSGACG00000007499   Transcript: ENSGACT00000009995
Sequence length 1797
Comment pep:known_by_projection group:BROADS1:groupXIX:8682372:8702387:1 gene:ENSGACG00000007499 transcript:ENSGACT00000009995 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FDLLMPPPAVFLPGVRQQESQKDPCLSGSCNPQLGDLMVGRSTQLSASSTCGLDEPQNYC
IIGYLEEEQKCFTCDSRLPYDRYGNTHSHRIENVITTFDPERKTKWWQSENGVHEVSIRL
DLETLFQFSHLVLTFKSFRPAAMLVERSKDFGQNWKVIRYFAEDCSLWFPSVSKQPADSI
DDVVCDSRYSGSDPSTNGEVVLKALDPIFELGNPYATNIQDLITVTNIRVNFTGLFTLGD
TLLGRRRRNPQDKYYYALYNMVVRGHCFCHGHASRCTPVDGGRGDVFTHTAMIHGRCVCQ
HNTAGENCERCQDFHHDSPWRPGGENPANTCRRCNCNGHSDSCHFDASRLEATGGLSGGV
CEDCRHDRMGSQCESCGPFLYQDPHRATDDPQACIPCDCDPVGSEGGGLCDALSGRCVCK
ENVEGRRCDQCRLGFFGLREDNPAGCQVCRCHVLGSLGSCDKLTGNCECDHLASGPQCDQ
CPAGFWGLGTSGFRCSPCDCDAGGAHSNMCSPQDGHCHCLPNMGGQRCSEPAPGFFLPPL
DYFLYEAELAAPLHSGSSSFPTTTPSPPSPSHLIYIHYLCLQVDPVVLPQCEKYYREQGY
DIKYTNGRLVLVRRTRRLAARRRRQQQNSLPLDPGHALQIIPRQRNDYQPLTWTGLGLVR
VLAGAGLRFTVDNIPSSLDYQLVINYESESPSDWLASVSVVKASPGDGGCRRDPTGSKSL
PLLGRSRRGVLDSPVCLTRGSRYFVDVVFNKHSGSDGFGAHILVDSMGLIPSIEAVQDFC
SQRDVDSFRQSHCIGLSVELQPEELLPKVCEGITKSLSARIHNGALLCRCNTDGSLGPSC
SEVGGFCDCKPNVIGRCCDTCAPLTFDFGPDGCKPCECDPRGSLSELCEPIRGQCVCRSE
LTGRRCDRCQPAFWDFPSCRPCECNKLSDVCDEQTGECLHCREHATGDMCERCVEGYYGN
PVSGQPCQPCLCPEVPNSGQFFATSCKQDPQSLALICKCREGHTVTVSGPRCDRCSPGFY
GDLGLPGNSCKQCPCNNNINPGDRDACNSLTGECQRCLYNTMGPRCQDCKPGYYGDAMDQ
ACKECSCDRRGTVVTECPLGSPCFCNSKTGQCPCRTGVLGILCDECADGYWNLQGASGCQ
ACSCDFVHSFSNICDKVTGQCPCRPEFGGRQCDECGENHFGNPDVQCISCDCNIEGTEHP
SCDPETGECICRVGVSGIFCDECTPGYVSEFPACNECHPCTALWAEDVTDVQRAAVRMRT
FLPHNGYGNMFPGDSRHLRQMLKMHSMLESLAELKGVSPPKLEKLEKLCAKMGKLQNSID
PNMILIDPSPLLNTEINNIRLEFKNLVTRVKTDPVLERVDEIQKLHEIQRLHEAFILDEK
RVRNGNKAIEDSMDTRHQVKHDLSMCSSKGNMMSVEKKVQQLSMVNLNKIICGGPGVEGC
SGCSEALCGENKCGGPNCEGVLPISQKALSTAERTKERFITLPSSMELFKNKINDGQRQA
KDTKDQGKNLQDQIKKNMDSLKSEKNKTKGLIQRVKDYLIDDMVPAEDIGKMAQAVLDIQ
LPKLPVINHINNLLSNATTSPKNLDDHAKDAQTLVHKAQEVREWTRNIDVTEISRDIYKA
EEAQSKANNNLDTGSQDKDVAKDQIKDIKNKLYDIEAKLMSPQPESLKDKIDALTRKTEH
NRNTTRRAQAAADSALNQTTDTEPELANVIWLFKLLKEKTANQTAAERLTKMMEEAEELK
EQVEEKLLQLFDMEEKIQQLIQNKEGKESEVAMLLQMVDSLQQEIAKRAKGYSICIS
Download sequence
Identical sequences G3NXA5
ENSGACP00000009974 69293.ENSGACP00000009974 ENSGACP00000009974

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]