SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000010706 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000010706
Domain Number 1 Region: 188-319
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.04e-16
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 2 Region: 21-78,130-191
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000173
Family Growth factor receptor domain 0.013
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000010706
Domain Number - Region: 308-335
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000509
Family EGF-type module 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000010706   Gene: ENSGACG00000008091   Transcript: ENSGACT00000010728
Sequence length 467
Comment pep:known_by_projection group:BROADS1:groupVI:9444769:9457463:1 gene:ENSGACG00000008091 transcript:ENSGACT00000010728 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGICVCLCAVFTHVVSQEAEEPVSYTVKCTEGYEYDTVREQCRDIDECALLDDACKGGM
QCINHFGGYLCLPKNAVIYISKEGEQGPLPESIPPGVAPVPPVPAVPAVPPNQPRFPWSA
GVSQPGRTVLCAPGYTADEQNLCRDVDECATGRHTCGAEQTCYNTRGSYTCQCPSGFQKN
GDHCVADRDECALTHYCMHRCVNTQGSYYCECNAGHKLASNNHSCVDVNECDVENPCQQH
CYNLIGSFLCQCEQGYELAQDTASCQDIDECSFSSYMCQYQCINSPGSYSCECPEGYQLQ
GSRVCQEDVNECETGTHNCHDDEMCWNYYGGFRCYPKNPCEPPYTKTSENRCICRSQAEC
QGLPPSIVYKYMSIQAERTVPADIFQIQATNMYANTHNTFRVKAGNEAGEFLLRRSSNVS
AMLVMTKPLTGPREYVVDLEMVTLHLTMNYRSNSLLRLTIIVGPYAF
Download sequence
Identical sequences G3NZD4
ENSGACP00000010706 ENSGACP00000010706 69293.ENSGACP00000010706

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]