SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000011715 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000011715
Domain Number 1 Region: 358-530
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.89e-63
Family SPRY domain 0.00000554
Further Details:      
 
Domain Number 2 Region: 10-79
Classification Level Classification E-value
Superfamily RING/U-box 1.13e-18
Family RING finger domain, C3HC4 0.0048
Further Details:      
 
Domain Number 3 Region: 142-207
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 1.53e-18
Family B-box zinc-binding domain 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000011715   Gene: ENSGACG00000008872   Transcript: ENSGACT00000011739
Sequence length 538
Comment pep:novel group:BROADS1:groupXIX:9986930:9990671:1 gene:ENSGACG00000008872 transcript:ENSGACT00000011739 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAASCLQTEDQFLCSICLDVFTHPVTIPCGHNFCKACITDHWNVNAPSNCPNCNQGFNT
RPELQVNTFISEMAAQFRLSTQQKASSSSSEQQAAQPGEVPCDVCTGTKVKALKSCLVCL
VSYCEAHLEPHLTTSGLKRHQLMDPVENLEGRMCTKHDKLLELFCKTDQMCVCMLCTVLD
HKNHDVVPLGEEYEGKKAELGKTEAEVQQMIQKRRLKIQEIKHSVELSEEAADREVAEGV
LVFSALKESVERSQAELIDTIKEKQRKKQKQAEGFIIKLEQEISELKKRSTEVEQLSHSE
DHLHLLQSFRTLNTAPPTKDWTGVRVSAPSYEGTVVRAVHQLEKKLSKQMKKLLEVELKR
VQQSAVDVTLDPDTAHPQLILSDGEKQVKDGAVEKNLPDNPERFNCYPVVLGKQSFSSGR
FYYEVQVKGKTDWWLGVVRESINRKGNISPSPQNGYWTIWLRNENSYSAWAGPSVRLSLE
SRPEKVGVFVDYEEGLVSFYDVGAAALIYSFTDCCFTEKLYPLFNCSDPGESLSLCRC
Download sequence
Identical sequences G3P292
ENSGACP00000011715 69293.ENSGACP00000011715 ENSGACP00000011715

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]