SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000012170 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000012170
Domain Number 1 Region: 246-287
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000719
Family SOCS box-like 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000012170   Gene: ENSGACG00000009224   Transcript: ENSGACT00000012194
Sequence length 288
Comment pep:known_by_projection group:BROADS1:groupV:11093608:11095789:-1 gene:ENSGACG00000009224 transcript:ENSGACT00000012194 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RPPASQPRSSGCMRSKDRMQPLPDEFMEFHPVHGSNVRLDFSGTQATRVESFANGVCFSK
RPLKPGEIFLIEIEDKELGWCGHLRVGLTARDPGSLDAVPEYSIPDLTDSGDSWVFAITR
NHNKIAEDPVEAADGGAAGKPKTFFTDSHLDIDDVRIPLDKLVGRSRPGRYSHILDDLYK
TNALPPTARRSRIGVLYVAKGRDLADMHIVINGEDMGASAKGIPSVQPLHAVVDVFAATK
CVRIVQVEYGFSSLQTLCRKSIQKHIVHRMAIDWLELPEALKHYCKYE
Download sequence
Identical sequences G3P3J7
69293.ENSGACP00000012170 ENSGACP00000012170 ENSGACP00000012170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]