SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000012581 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000012581
Domain Number 1 Region: 56-92
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000872
Family EGF-type module 0.016
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000012581
Domain Number - Region: 17-123
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000439
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number - Region: 419-684
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000769
Family Rhodopsin-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000012581   Gene: ENSGACG00000009517   Transcript: ENSGACT00000012605
Sequence length 689
Comment pep:known_by_projection group:BROADS1:groupVIII:12042434:12053544:-1 gene:ENSGACG00000009517 transcript:ENSGACT00000012605 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VMRLGVLAWLSSLMDPCSLSNNCHQCHPLAACKAQNGSNPACFCNQGYTGDGTTFCEDDN
ECRNVTNICGDRGNCTNTVGSYYCTCVSGYTSTGVAKFQPNDGTECIGNHPQKYCHDNIG
CITQTVNKTLEYMSNLTEPQSLLDEIAKQTSGELTSVEVIAYVEALCRSASTLAAEEKDY
AVKPSVINSTLTKLVKAVNNLVEKDELVAWSRMKEDRREHTITKLLHSVEERALTLANNY
KTPAEIEIKASEMELKVFTFDVRHMKATLSASMGGDHINLTPKLRPQGDRNGSVSVLFVR
YDSIADILKPSGDPGVTDYSRRAEAGEITVNSQVIAAAVKPADVYQLDHVTFVLKHNQPV
DAAADGTTCAFWEYEPGSFRGHWATHGCKTVHVSSNATTCSCDHLTHFAILMSSGRADLA
AHNTTLTRITQLGMIISLICLSMCIFTFWFFSEIQSTRTTIHKNLCCSLFMAEFIFLVGI
NMNTHKLFCSVIAGLLHYFFLAAFSWMCIEGIHLYLIVVGVIYNKGFLHRNFYIFGYGSP
AVVVAISATLGSKYYGTDKVCWLSTENHFIWSFIGPACLIILVNLLAFGVIIYKVYRHTA
VKRPEISHYQNIRSCARGAFALLFVLGATWTLGVLHILNETTLTAYLFTLANAFQGMFIF
IFLCVLSRKIQEEYYRLFKNVPCCFECLR
Download sequence
Identical sequences G3P4Q8
ENSGACP00000012581

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]