SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000013425 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000013425
Domain Number 1 Region: 469-835
Classification Level Classification E-value
Superfamily L domain-like 1.41e-42
Family Ngr ectodomain-like 0.014
Further Details:      
 
Domain Number 2 Region: 26-250,293-431
Classification Level Classification E-value
Superfamily L domain-like 1.43e-30
Family Ngr ectodomain-like 0.0089
Further Details:      
 
Domain Number 3 Region: 896-1048
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 6.93e-27
Family Toll/Interleukin receptor TIR domain 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000013425   Gene: ENSGACG00000010164   Transcript: ENSGACT00000013450
Sequence length 1064
Comment pep:known_by_projection group:BROADS1:groupXII:12738369:12742107:-1 gene:ENSGACG00000010164 transcript:ENSGACT00000013450 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YYNFTNMAMLNIFLILCQLLPIVRMINTVFFPCDTDGNTTAVDCYGRPLTSFSFIRSPTV
VSLNLSETKILQLRQHALSGVPNLETLEIKGNCQPGDLRALEDRSCKMEIHDDAFKRLLK
LKYLYLSGNSLTTIPWLPESLMVLDLQFNNIFNILQPLNTPNLQILHLNSNCFYVNPCNQ
SFNISERVFRELPKLKILTLGYNNFSAIPKGLPPSLERLDLKENRITEVLEYAFANLTLL
NDLNLEWNCQRCDHAARPCFPCPGNLPLGLNPHSFYAYEIQHRLPQLERKLFVNLPELFW
PLENLKGLDLSDNLLAYTIRNGTIFAELKGLTWISLIYNYEPLWTFREMILSPYFGNMSN
LQRLLLTGNFFHTLSLESLDIVSKLQNLKVLELRMNFINTCNMTSLKRSTSLINIDLSQN
MLNFHPCCSSPSFQIGQQESCQNQKSYSHNFPDQTLMLIDRKATSGSDTWEYNHSERLAL
FENNVSQIPSLLDFKKKFCNGKLLLDLSQNDILSINNNMFVGMENAVCLNLSYNYMNQAL
KSGLFKNMKKLVVLILSYNRLDFYYKDALSELKETLKVLDVSGNEFHFQMRGMGHRFEFL
QNLTNLEFLSLANNGIGMRIDHRLISRSLKYLYFSGNHLDIMWDSDNKYTHFFQNLTNLT
FLDISDNHLASITPEVLVNLPGSIETLSISNNLLKYFPWQNISALANLCHLNLSQNFLYY
LPHTVIEFGVDFSLLDLSHNHLTNIPEGFFRMATSLHYLYLSHNQIKALNHQFLPAPFKN
GSALQKLTLHANPFKCDCDTSWFADFLRTTPVQIPYLTTDVHCDYPESQQGVSVLSMDQR
SCQDIYGGLAFVVCSFFAVAFTVLPLLKHLYGWDLWYCLQVLWAGHKGYSQLAGRDSQYR
HDAFVVFDTQNRAVRDWVYNELMVILENTGHRRFSLCLEERDWIPGLSCIENLHNAVYNS
AKTVFVLSSGATGGERVTGVIRQAFFMVQQRLLDEKVDAAILVLLDEMFPKLKYLELRKR
LCRKSVLSWPRNPRAQPLFWNQMRMALSSDNLRSYDNNMSESFI
Download sequence
Identical sequences G3P751
ENSGACP00000013425 69293.ENSGACP00000013425 ENSGACP00000013425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]