SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000013579 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000013579
Domain Number 1 Region: 518-801
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 3.7e-39
Family C5 cytosine-specific DNA methylase, DCM 0.0078
Further Details:      
 
Domain Number 2 Region: 187-321
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 2.17e-34
Family PWWP domain 0.00000336
Further Details:      
 
Domain Number 3 Region: 419-492
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000617
Family PHD domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000013579   Gene: ENSGACG00000010273   Transcript: ENSGACT00000013604
Sequence length 803
Comment pep:known_by_projection group:BROADS1:groupXII:12823810:12833361:-1 gene:ENSGACG00000010273 transcript:ENSGACT00000013604 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SISQQINIMSRFSVKVNKSPSLRLCPQAPVNGDVPPAKGLAESDSGVELTNDNSPLTAAE
PPSPFSPKQNGDAASPQDGNQGSGGSRKRSRKKSEEEETTWDSDSEDKTSGASQLGLRQT
PRPRTIFQAGLAPHTHNKPRRQNRKQEPSMSLSGGVPEATRPELMEQDSKDSAQSVSTSS
SQEIQPEYKDSKGFGIGELVWGKIKGFSWWPGMVVTWRATGKRQASNGMRWLQWFGDGKF
SEVSADKLDSITAFAKFFSQASYTKLASYRRAIFQALEMASIRAEKKFPPCESDSPDDQV
KPMLDWANGGFLPKGEEGLKPTHTADSNPLHHQVPDVSLPEYFPSAKRPRVSLQKSKAAP
EESYSREQMVNEVLKNKRSIEDFCLSCGKMRAATFHPLFEGGLCQTCKDVYLEMSYMYDD
DGYQSYCTVCCGGREVLLCGNANCCRSCFCVDCLDILVDPGASNNARYLDPWRCYMCQPT
LQYGALKRRHDWSIKLQIFFTSDNGQEFEKPKIFPAVPAEQRRPIRVLSLFDGIATGYLV
LRDLGFKVDQYVASEVCEDSISVGVVRHEGKIQYVHDVRNITKKNLLEWGPFDLVIGGSP
CNDLSIVNPARKGLYEGTGRLFFEFYRLLSEAQPEGGDDRPFFWMFENVVAMGVNDKRDI
SRFLECNPVMMDAIEVSAAHRARYFWGNMPGMNRPLCASGMDKLELQDCLDHGRVAKFGK
VRTITTRSNSIKQGKDQHFPVLMNGKEDILWCTELERIFGFPVHYTDVSNMGRGARQKLL
GRSWSVPVIRHLFAPLKDYFACE
Download sequence
Identical sequences G3P7K5
69293.ENSGACP00000013579 ENSGACP00000013579 ENSGACP00000013579

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]