SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000013626 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000013626
Domain Number 1 Region: 170-242
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.67e-24
Family PHD domain 0.0000132
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000013626   Gene: ENSGACG00000010292   Transcript: ENSGACT00000013651
Sequence length 245
Comment pep:known_by_projection group:BROADS1:groupXX:11805349:11809458:-1 gene:ENSGACG00000010292 transcript:ENSGACT00000013651 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYLEHYLDSIENLPFELQRNFNLMRDLDQRTEDLKGQIDSLAKEYTANARTLSSEQKLSI
LRQIQQSYSKCKEFGDDKVQLAMQTYEMVDKHIRRLDTDLARFEADLKEKQIESTDYDST
SSKGKKVETRQKEKKTAKTRSKVKSSDEDGSPKSAQKKVKLLQPGEFNSPTNNFGNVHPS
DVLDMPVDPNEPTYCLCHQVSYGEMIGCDNTDCSIEWFHFACVGLTTKPRGKWYCPRCSQ
DRKRK
Download sequence
Identical sequences G3P7Q2
ENSGACP00000013626

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]