SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000013658 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000013658
Domain Number 1 Region: 126-322
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.35e-57
Family Prokaryotic proteases 0.000000662
Further Details:      
 
Domain Number 2 Region: 337-431
Classification Level Classification E-value
Superfamily PDZ domain-like 5.13e-22
Family HtrA-like serine proteases 0.0015
Further Details:      
 
Domain Number 3 Region: 3-79
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000549
Family Growth factor receptor domain 0.0027
Further Details:      
 
Domain Number 4 Region: 66-111
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000025
Family Ovomucoid domain III-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000013658   Gene: ENSGACG00000010338   Transcript: ENSGACT00000013683
Sequence length 436
Comment pep:known_by_projection group:BROADS1:groupVI:12799873:12816756:-1 gene:ENSGACG00000010338 transcript:ENSGACT00000013683 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAHCPAGQILDACHCCQVCASGEGEACGGLGKLGDPVCGEGLECSVSAGVAYTTTVRRR
SKSGTCACKSAEPVCGSDGVSYRNVCELKRVSRRAQKLQQPPVVLIQRGACGKARDNPDS
PRHKYNFIADVVEKIAPSVVHIELFRKMTYSKREVAVASGSGFVVAEDGQIVTNAHVVAN
KHRVKVELKSGGTYDAKIKDVDEKSDIALIKIDVPTKLPVLPLGRSSNLRPGEFVVAIGS
PFSLQNTVTTGIVSTTQRGGRELGLRNSDMEYIQTDAIINYGNSGGPLVNLDGEVIGINT
LKVTAGISFAIPSDKIREFLAEAYDRLSRGRAAAKKKYIGVRMMTLTPSLAKELKTRHLD
FPDITSGAYVMEVIAKTPAAVAGLKEHDVIISVNGQRISSATDVSAAVKRDGSLRVVVRR
GNEDAILTVVPMEIDP
Download sequence
Identical sequences G3P7T4
69293.ENSGACP00000013658 ENSGACP00000013658 ENSGACP00000013658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]