SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000013847 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000013847
Domain Number 1 Region: 610-901
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.5e-72
Family Protein kinases, catalytic subunit 0.00000000998
Further Details:      
 
Domain Number 2 Region: 1-184
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.53e-55
Family Ephrin receptor ligand binding domain 0.00000649
Further Details:      
 
Domain Number 3 Region: 313-525
Classification Level Classification E-value
Superfamily Fibronectin type III 1.65e-33
Family Fibronectin type III 0.0000854
Further Details:      
 
Domain Number 4 Region: 905-974
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.7e-16
Family SAM (sterile alpha motif) domain 0.0015
Further Details:      
 
Domain Number 5 Region: 243-314,354-375
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000157
Family Growth factor receptor domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000013847   Gene: ENSGACG00000010474   Transcript: ENSGACT00000013872
Sequence length 980
Comment pep:known_by_projection group:BROADS1:groupXX:11946010:11966840:-1 gene:ENSGACG00000010474 transcript:ENSGACT00000013872 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLDTTESTSELGWTTYPDTGWDEVSVLDDRGKLIRTFEVCNVNQNPRLQDNWLATPFLY
RHSAPRVFVTLRFSVRDCASLRSPSPTCRETLTLFYKQADSQRELPSNGEKDTREGWVKI
DTIAADKSFSKVEPSSPHQYQPNRYSRINIKTRSFGPLTRNGFVLAVVDSGACVSLMGVS
IFYRRCPATSVHLASYPATPSGAEPTALVPLSGTCVPHSKAQGGTPPRMHCNTEGEWMVP
VGGCVCDEGHDQNLNGSACLACPVGYFKSEAGSTPCSVCPSNSRTGQEGSSVCECRSAFY
RAANDANSSDCTTPPSAPASLSWEYESADGGVSLRWRPPVDMGGRSEVWYGVVCRICPSA
TFSNPAACSWCGEGVTFSPAQTNLKQTKVTLNNLLTRVTYLIQVQAMNEVSALSPFPARY
TSINFTTSQSVPSTVPMMHQLSRAPDSITLSWPQPDRPNGDILEYQLRYYDKGSDVDSAA
SVYSETNTVTINPLIPGSIYAFQIRARNERGYGPYSSTVYFTTLPLEEHSHQIQNRLPLL
VGSVMGGAAFLLVVAAIVVVVVFRRKRRESPYSDRLQRYISNRGFGGAVKYYVDPSTYDD
PSEAVKEFAREIDPTHLKIEEVIGAAQFGEVSRGRYRPMGRRELLVAVKSIRWGASDRER
GLFLSEAGVMGQFDHPNVLKLEGVITHTSPERIITEFMENGPLDAFLRENEGQFSVLQLI
GMLRGVGAGMRYLSERNFVHRDLAARNVLVNSNLVCKVSDFGLSRLMRGLDHNIPTYTAS
LGSKIPVRWTAPEAFQHRKFSSASDAWSFGILMWEVMSYGERPYWDMSNQEVMKAVADQY
RLPAPHNCPSALHSLMLQCWQNDRGERPGFDSLLSSLDRLIRHPASLKVEPTRSCSQPLL
SPTPTDLTAVATVGDWLKALRMERYQDEFDQAHLDTLDRVSMLSMEDVQNLGVNLLGHQR
KIVSAAQQLRAFLTQGQVEV
Download sequence
Identical sequences G3P8C3
ENSGACP00000013847 69293.ENSGACP00000013847 ENSGACP00000013847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]