SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000013856 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000013856
Domain Number 1 Region: 279-365
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000144
Family I set domains 0.02
Further Details:      
 
Domain Number 2 Region: 46-128
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000019
Family V set domains (antibody variable domain-like) 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000013856   Gene: ENSGACG00000010484   Transcript: ENSGACT00000013881
Sequence length 428
Comment pep:known_by_projection group:BROADS1:groupXII:13309389:13315787:1 gene:ENSGACG00000010484 transcript:ENSGACT00000013881 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSQLATSLMLYRPGAWSYEAPEDKQDAFARKACPAFLTFTNAAFLAGVTVEVPCRCKPQQ
IQSVVWFFRKHLSGSKETRALTDHHGNRLLDPDSVPHGGGLRSRFSIRLFSLLIFRAEPA
DSGIYICGSVHKDFFYGYDLDIQEARTLSFIRSISQKNEERKRLGSTKPLYQVFTSFRPW
SVCDRCGLPGEQVRVGLCYVHSHYLHVRFRRANQTVTSCGSGAVLRAFGRLRQSSVGAKL
EVKSCEATCGDRASQSTKITALMAFLGLNSASLPVFYLKAPTDRTLTLGCPGARPDMAVA
WDRGFKPVYRSERWAGRNLSDTPPRLHVDTGHNLVFQPAKTPDSGVYYCWLEGHRAAEIR
LLVYVHLGRGQSVTLHPDFWEAMFFLLRSYYILLVISILFLTILHIIHCSYCQKRCCPNR
SSNLSLEI
Download sequence
Identical sequences G3P8D2
69293.ENSGACP00000013856 ENSGACP00000013856 ENSGACP00000013856

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]