SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000013942 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000013942
Domain Number 1 Region: 173-249
Classification Level Classification E-value
Superfamily Homeodomain-like 3.34e-18
Family Homeodomain 0.0000587
Further Details:      
 
Domain Number 2 Region: 54-120
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.81e-16
Family LIM domain 0.016
Further Details:      
 
Domain Number 3 Region: 23-52
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000111
Family LIM domain 0.022
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000013942
Domain Number - Region: 117-144
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00228
Family LIM domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000013942   Gene: ENSGACG00000010533   Transcript: ENSGACT00000013967
Sequence length 359
Comment pep:known_by_projection group:BROADS1:groupXIX:12092410:12095937:-1 gene:ENSGACG00000010533 transcript:ENSGACT00000013967 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDILLNSSFLDDMGDHSKKKSGFAMCVGCGSQIHDQYILRVSPDLEWHAACLKCAECSQ
YLDETCTCFVRDGKTYCKRDYARLFGIKCAKCNMGFCSSDLVMRARDNVYHVECFRCSVC
SRHLLPGDEFSLRDDELLCRADHGSLAERASAGSPLSPGNIHSRQLHISEPVSVRHPPHH
RSHVHKQSEKTTRIRTVLNEKQLHTLRTCYNANPRPDALMKEQLVEMTGLSPRVIRVWFQ
NKRCKDKKRSILMKQLQTQQHSEKTNLQGLTGTPLVAGSPIRHDNTVQGNPVEVQTYQPP
WKTLSDFALQSDLDQPAFQQLVSFSESGSLGNSSASDVTSLSSQLPDTPNSMVPSPVDT
Download sequence
Identical sequences G3P8L8
69293.ENSGACP00000013942 ENSGACP00000013942 ENSGACP00000013942

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]