SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000014119 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000014119
Domain Number 1 Region: 244-323
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 9.31e-20
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 2 Region: 177-241
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000351
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 3 Region: 125-193
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000364
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 4 Region: 46-107
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000108
Family Complement control module/SCR domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000014119   Gene: ENSGACG00000010664   Transcript: ENSGACT00000014144
Sequence length 333
Comment pep:known_by_projection group:BROADS1:groupXX:12303602:12308961:-1 gene:ENSGACG00000010664 transcript:ENSGACT00000014144 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CPDRLLGEESRRTCPRPCKADRDCGNRRQCLCDGQCGLSCVAPGRTCPWPLPPSEDSEAR
LLSPTHSFSALLEVRCKPGFALPSGLDATIRRCQGDRRWSGEEPICTDPLPSEASGTRSP
ASTQSCPLPEDIVDTFSIQGDAAAGTSIRYTCLSGSDIVGSRENFCQDNQTWQYPHPICK
EVYCQPPREVQQGYVVAVQKTEYEVGFDIHYLCKKNFLLDGPQKVTCLSNGSWSASPPHC
RARCLIPAQRSRVVIGGVKRWPFDVTDTLVPHGEHVTFFCKHPRKQCSFSATQTCFDGRL
QTPACYLEPTWLQFKLPHRLVSEIEACGPDDVE
Download sequence
Identical sequences G3P945
ENSGACP00000014119 69293.ENSGACP00000014119 ENSGACP00000014119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]