SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000014488 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000014488
Domain Number 1 Region: 286-445
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.42e-32
Family SPRY domain 0.00086
Further Details:      
 
Domain Number 2 Region: 11-78
Classification Level Classification E-value
Superfamily RING/U-box 4.78e-21
Family RING finger domain, C3HC4 0.087
Further Details:      
 
Domain Number 3 Region: 86-142
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000397
Family B-box zinc-binding domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000014488   Gene: ENSGACG00000010950   Transcript: ENSGACT00000014514
Sequence length 458
Comment pep:known_by_projection group:BROADS1:groupXVIII:10993513:10995428:1 gene:ENSGACG00000010950 transcript:ENSGACT00000014514 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSTSLSEMDFTCPVCCDIFHDPVVLLCGHSFCEHCIQEWWTQSRLKTCPVCQELFPMA
QPARNLALRNLSDAVRQEKIQRANATSEEMCDLHGEKLKLFCCYDRQLVCVICRDAQKHK
KHNCVPLDEAVGPCKAQLKLSMVNLKTKLGRFKAQKSKCDKIAGHIKWQAQQTEKTIKEE
FQKLYHFLQADEAARIEAVRKEAKFKSVAIDIAIVNLTADIASLSDKLKAVEMEMAADDL
SFMLNVKSNIERSQCKLPYPEVPWGALIDEAKHLGNLLFAVWQKMKNIIQYTEAPVTLDP
NTGSSRVTISEHMTRCAKSYKNQPLPENPERTLCSDVLGSEGFSSGAHSWDVEVGGYWFL
GVAPRTNVRTYENVWGIYINGCLERLFERDQGNNSKVVSEHSFPQNVRVHLDYDKGILSF
FDLDRKTRVHTIKCAFTQTVFPCFSENAKILPYEFSVR
Download sequence
Identical sequences G3PA64
69293.ENSGACP00000014488 ENSGACP00000014488 ENSGACP00000014488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]