SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000014781 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000014781
Domain Number 1 Region: 3111-3166
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000181
Family RING finger domain, C3HC4 0.0042
Further Details:      
 
Domain Number 2 Region: 1546-1675,1713-1805
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000501
Family Extended AAA-ATPase domain 0.045
Further Details:      
 
Domain Number 3 Region: 1897-2133
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000466
Family Extended AAA-ATPase domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000014781   Gene: ENSGACG00000011165   Transcript: ENSGACT00000014809
Sequence length 4287
Comment pep:known_by_projection group:BROADS1:groupXI:9259253:9281472:1 gene:ENSGACG00000011165 transcript:ENSGACT00000014809 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TAVKLLQKLCNGVKSVYSQKYCDIPVACINLVASVSDFVHWNEPQETPEGGREQQYGKDS
VISEAKDIMRTWISWSFKDALLKSSFTSLYRVEATSEIEESAENQIEFYCKKIEELSESH
PHVAASVERCALEAVTSLCQTKSEGKVFEKFKVNSKFGKLISAIIQKSWPKDNHGNYREE
EELVLQHLLSWTAAKDYFKLHGTDEKLIEKLSQDARDRIAIAISSFSAIVNRLVHGDIKT
SLLNIVLEKRNAFLELLKIDLMSTDCLSENEQYRDNAKMKRLLQCREAELKDVYHEKALL
DIFLTKSNVLGTYMTVDLSGMQEKQQVNIELMPLNQFMEVHPFDRMASSQTGVVTYFDLD
EDIRNMAEVLSTFKDCHIFSVFWENTAKRMVATETEDDYLNQDEEEDDIVATPEMIHDDI
FQPCYAKYRDLYTCLKDGSIRLEEVNQFFRDYKGKYEELAEELDIMRNVDKSPDKQWILT
RVQQIEQYHELHLAVASAEMITKVKETLCLQGDFRVLETLTGVNHADFQTEQLNRIDDDL
MQAKMALVDITESRRQCLQELGLRGHFVKWVKDALEDINELKVFVDLASISAGENDMDVD
RVACFHDAVLGYSSMLYELKPDSGFHVFKEVVKKLWRALENDSNLPKKLRDSARHLEWLK
TVKDSHGSVELSSLSLASAINNKGIYLISAQGVKKLSLDTALKLQIPEEHDEGQQMRSYS
LEDLRELQNKLMLMSGKGDQGQNEVDHFAEVFASVQRLAEAFIALYTAGNPLFRHWEATI
NCSLRSEEPSIVMDFNLGSVLSIVIVEGSIEEQLPEFCRKMEKCLHYWMNFVDKQRSLHY
YLNYYTAEQVVYLCSKLSQQNVTNVEDQILMMLSFVKSNCTASDLRQVWHELQYEILTKP
LEQNEDIEFQTELDPLLSLAEQANGSQKFDLIWNAYMKDMKDYLPHILDIRSLGRLLEIL
ANKKDESEEDVSPYNILDFVRRLLPQGLTTGNPNLVVCPHDEVLTSCISVYMSSGHETLP
TYDEVLLCNSSTPYEQVELFLRRCLSPGYPGQKIYCLLFGDLLTYDVSSKVENFFQRIKM
QSRKDYRLVIICSSEREHAYLPSAFSRYRLHVVPQEPLARIQQYLHKHYAVPEDQCSAAA
AFKDRLCVGVVSSKRAGVAGKSLYINRLHSKLKCLTEKPSMMRCIRLVEPNVDENVILQS
LLDTPKRKELTMFHFDVTSVVQKGLHEFLFKLLILRYLMDSEGKTWKCSDEQLYVIEILK
PTASENTTFTDVFPNIFCRPPKKVLMLEMRKQEDPNIVSTDDPLMDDEEFRSASFQRPYQ
YLTRFHNHNDLDGFRYQDVEGSHVECLQMLLMYCGMLDPSWAELRNFAWFLNLQLKDCET
SVFCDATFTGDTLTGFKTFVVDFMILMAKDFATPSLSISDQSPGILQTDSGVKDEDLAPF
LIRKRWETEPHPYIFFNDDHVSMTFIGFHLRPNEQNSVDAIEPNSGRVIKKNVMTRVLYE
GLQLQRVPFNIDFDGLPRGEKIERICNVLGIQWPLDPDETYELTTDNILKMLAIHMRFRC
GIPVIIMGETGCGKTRLIKFLCELRRGGVATENMKLVKVHGGTTSEMIYTKVREAETVAS
INKLDYGFDSVLFFDEANTTEAISSIKEVLCDETVKGESLTPNCGLKVIAACNPYRKHTD
KMIRRLESAGLGYRVGAEETDEKLGSIPLRQLVYRVQALPPSMIPLVWDFGQLNDDTEKI
YIQQIVQRVVERKAIDQSYIKCITDVLSASQKYMRTRKNECSFVSLRDVERCMQSFVWFC
DNHVMLFAELEKFESDQKAERNERQHRQPDGRDPVLWSLVMAIGVCYHACLEKKDKYRQK
ISTSLPPAYTSAKVMQEISLMQDLLLNGVPMGDTIARNSALKENVFMMVLCIELRIPLFL
VGKPGSSKSLSKTLVADAMQGQAAHSDLFKKLKQIHLVSFQCSPHSTPEGIINTFKQCGR
FQEGKNLDEYISVVVLDEIGLAEDSPKMPLKTLHPLLEEGCIDDEPQPHKKVGFIGISNW
ALDPAKMNRGIFVSRGDPDEKELVESAKGICNSDAMVLEKVRDTFKPFAKAYMHICHEGG
KGFFGLRDYYSLIKMIFAVAKAFQRKPTGEEIVKAVLRNFSGRDDVDAVSVFTKSLNTSP
NVRSISAVEFVRENIQAVGQEEECRYLLVLTKNYAALQILQQTFFSDSGQPEIIFGSSFP
KDQEYTQICRNINRVKICMETGQTVVLLNLQNLYESLYDALNQYYVCLGGQKYVDLGLGT
HRVKCRVHRDFRLIVIEEREVVYKQFPIPLINRLEKHYLDIQTVLKTEQKEMVDHLEKWL
RLFVSLSSHHAAVAYKYQPPDVFIGYHSDTCASVVLQVIEKQKDSAEVSDPERRILDEAK
LILLRCATPDSVVRLDCTGLPKVESENLARVYFKEQNNSCLADFIIAHTMQEVHCYSSFT
EVTTFSRLLTASDLEPLEQLLHSVELLSLQQFDTEHSYLKKIRNFLTAKKGISNTKPCNK
ILLIQCDFDEASHSANLIASAKYSSINEINKLTQESMGSRVFVYFITRLPRVEGGTSYVG
FHGGPWRSVHIDDLRRSKDIVSDIKALQNMTISQMFETKKDEPEAMELDDMYTENEQEEA
ESKENIVDTTALVRSCVQSAVGLLRDQVESGLRSTQRVEILLTLLSDNDEVKGEFLQTVK
RHLHLLLATRESKAFSSTKNNWVIKEASNIDALQEGGTFRHTLWKRVRAAVVPLLAQLLS
VIDRDQNLDLLLDGNCGEFVKRLWLDIFGNEKLLDIPHLTLDQNSETRTILVQNYIAQDR
NVTCSMPFSWRIKDYLEELWVHAFQHEGHTQGEFDELFWKTPLGRYITKADEETQREFFQ
RYLQDFIAMTMNVTCPEDLQLLCGALNCCVSELRLQLDAADTALSLPWVHAAYHKFKNRL
QNLSRMICIEPQVTQDLISNHHTRGGVELVLDTYAAFACVEYLEPRLLDTNVQRQAWLRQ
VKKLQVPIELICSEDSVRHYGERSKVIARRVQAGWNRIFTLSLFVEHMLLDIEHVEEKLA
PLVLKHTKLLCQLLEKNSDLKTKESFEEVIGLLKTCKDAAIECIFRFGLPICSVCMGDPQ
NPLCLPCEHVYCVACIKQWLVPGQMFCPLCIHPIDEDFLMVPSDTIRIHIQQHAQFRKQC
NAFFIDLVSTVCFKDNSPPCSAVILHLLSFLMVEANTVPILRGKRHILTKVLSPFDDSVD
KNPVVRSVVLKLLLKYSFDEVKDYLQQHLVAVEQSNILEQTDKTELYSLYMNCLEDSMFE
RLHFRSIADRRMCLQAERDFLTDFLQSHGRCAETATVEYLQQLARVRMDLDMAAGLITEK
HGATAESQEPDQSGTTAFLTSAINLCRRSGNDWYRVYLIRKICSQHGVEFVLTLLKVAEM
RWLFPEEVLQKGEEVTPTDQYLVCGEDYKTIRNAVAKGVMEGKVTGLDEACEGCRKSPQW
TAVYLLLALYREVTTLYRDDNVAFHPKPEQLEAFTTYIQNSRVLASPRMKAFASALVTNQ
LRSLVVCPGATGTQSVLVDLSIHLAAVLLCGNEQILAPLQNLSMQPADMQAAFLPTMPED
MLEVARQAMGPLQWYYCPNGHPCTIGECGQPMEKSFCLDCRVEIGGIDHRPVTGFQIGQL
PGDRTQTGHVLGDPGRRDNPDMLDTKSISLVPFTVVRMLTHMAMLLGTCGQPEAISAIIR
PQVTDPSAFLLAHLRKDMEHLIRSLGKGTDDTVTAVHLLISSLMEPRQHPTWPVPYNNGL
STKEARNGWEMEVSTAIITPQLKHLDRRLKEVNAFIRTDSRISANPIMKLMFGDPLLFLA
SLPQNSLIHGSAVWCCREKVSLLSLTHIVEQNDGKDTVPVLWRFLHREAEVRAVKHLPDI
LTLQRDLVKKFQNITELTCTTIAEFLQDQKAASLKARYEKYIQIFLTTWNQLRVSLATNG
EIQLPAEFCQKDLDHSSDLKVLLPRRQGPGLCSTALVSYLIALHNDLVYCVDKHTGEETS
YKVSPADLTDLHVIRYELERDLMPLVLSNTQYSIESGQETLHEYDLPKIQQQIVSRFLQG
KPLITLNGIPTLVNRHDRDYEIILKDVKAKVQQVGFGTDSPGTNRLQIAHLGDNLFFFFF
VPSHFYETLSICCLKHCVALWQLLASLKSEKMLRLKGDPFVEVSETYKVALGEDEHRLLT
GFFSKSSGDNFLLEMHEFLLLVLKKPNAPDTYKPDWSLKITLVSYMERKDLDPPPDVEEL
FPEEICLSQYIEAWKFIMAFKQERGQR
Download sequence
Identical sequences G3PB07
69293.ENSGACP00000014781 ENSGACP00000014781 ENSGACP00000014781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]