SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000015440 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000015440
Domain Number 1 Region: 2-149
Classification Level Classification E-value
Superfamily C-type lectin-like 4.37e-30
Family C-type lectin domain 0.0000121
Further Details:      
 
Domain Number 2 Region: 226-299
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.42e-16
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 3 Region: 162-237
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000128
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 4 Region: 288-363
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000347
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 5 Region: 347-411
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000195
Family Complement control module/SCR domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000015440   Gene: ENSGACG00000011663   Transcript: ENSGACT00000015471
Sequence length 467
Comment pep:known_by_projection group:BROADS1:groupVIII:15021834:15025098:1 gene:ENSGACG00000011663 transcript:ENSGACT00000015471 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WSYYYSNKTMNWEEARTWCREHYTDMVAIQNQDEISHLNSWLPKASSYYWIGIRRINKVW
TWVGTNKALTPEAANWAIGEPNNLKSRKRSMASEDCVEMYIKRDSQAGKWNDERCAKSKT
ALCYTAACKKDLCGHGDCVETINSYECACFEGFYGEKCDQVVRCPVLSSPAGGSMKCSDP
LGPSGYRSTCAFACDEGYVLAGSTSNTLQCEASGIWNASQPLCLAVQCPSLLQPDNGFVS
CGDDAGKHQYGNTCSFSCAAGYLLVGPSKMTCTSAAVWSERKPRCEVVQCPVLSSPAGGS
IKCSDPLGPSGYRSTCAFACDEGYVLAGSTSNKLQCEASGIWNASQPLCLAVRCPSLEAP
ENGHINCSNSEPVFNSQCTFSCNQDYSLDGHELLTCDRHGEWTTGQKPTCQAPPSAVTAV
ASGVAAGGAMLSGLSLALWIMKRLKQKANKFELSRLDKAFTKPKLCL
Download sequence
Identical sequences G3PCW6
ENSGACP00000015440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]