SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000015447 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000015447
Domain Number 1 Region: 161-222
Classification Level Classification E-value
Superfamily Homeodomain-like 4.28e-16
Family Homeodomain 0.0037
Further Details:      
 
Domain Number 2 Region: 37-101
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000232
Family LIM domain 0.013
Further Details:      
 
Domain Number 3 Region: 9-35
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000126
Family LIM domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000015447   Gene: ENSGACG00000011682   Transcript: ENSGACT00000015478
Sequence length 354
Comment pep:known_by_projection group:BROADS1:groupVIII:15033437:15041414:-1 gene:ENSGACG00000011682 transcript:ENSGACT00000015478 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLADMDQGAVCAGCHQLIRDRFLLRVTDGLWHEGCVRCAACGDALRASCFLRGRKLYCKR
DYADLFAVRCGGCAEAISPAELVMRAGSAVFHLRCFTCRVCSCRLQTGDRCVLREGQLLC
AREDFHRCAASQTSSDTGTGSRVTLDSGEMQKTRVRGRRVRSEDLESKRPKRPRTILTTQ
QRRTFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQREWAHMKKLARRQQQQQDQ
QRTQEQREHPPHHTAPSCGSLTSELEHLGSSYTHMALTTLEPQDYDMDPFRQGLTPPQMP
GDHMHPYGFKGLYGAMDTDPLCHVADSDCLSLGDSSLLTPIDRLYSMQDSYFTS
Download sequence
Identical sequences G3PCX3
69293.ENSGACP00000015447 ENSGACP00000015447 ENSGACP00000015447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]