SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000015669 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000015669
Domain Number 1 Region: 70-148
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000417
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0055
Further Details:      
 
Domain Number 2 Region: 305-354
Classification Level Classification E-value
Superfamily RING/U-box 0.000000495
Family RING finger domain, C3HC4 0.014
Further Details:      
 
Domain Number 3 Region: 242-278
Classification Level Classification E-value
Superfamily SAP domain 0.0000244
Family SAP domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000015669   Gene: ENSGACG00000011849   Transcript: ENSGACT00000015700
Sequence length 360
Comment pep:known_by_projection group:BROADS1:groupXIII:13260415:13265325:1 gene:ENSGACG00000011849 transcript:ENSGACT00000015700 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALGSRSSLLLSSSRRAAAAMKAGASSMWASCCGLLNEVMGTGAVRGQQPGFGAGAGPFRF
APSAGYSTYPPSGSGTPGLVCKSCGQAFSVFRRKYICRDCKKSFCSLCSVLQENLRICAT
CHLLNATAFQRPLLMRLRVRDLRQYLLLRNIPTDTCREKEDLVDLVLCHQGIEEEEGLST
AQSASELSAFVASREEQLSRSDSSDTNQGTWESQGAVLSRPQNPQTRCRARASLSDISSL
RDIEGLSVRQLKEILARNFVNYSGCCEKWELVERVNRLYRETEENRKSLENVSTTVTADG
EKGPLTIQDDNLCRICMDATIDCVLLECGHMVTCTKCGKRMSECPICRQYVVRAVHVFKS
Download sequence
Identical sequences G3PDJ5
69293.ENSGACP00000015669 ENSGACP00000015669 ENSGACP00000015669

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]