SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000015894 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000015894
Domain Number 1 Region: 187-253
Classification Level Classification E-value
Superfamily Homeodomain-like 1.15e-19
Family Homeodomain 0.0032
Further Details:      
 
Domain Number 2 Region: 60-125
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000346
Family LIM domain 0.013
Further Details:      
 
Domain Number 3 Region: 31-58
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000803
Family LIM domain 0.012
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000015894
Domain Number - Region: 121-149
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0129
Family LIM domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000015894   Gene: ENSGACG00000012015   Transcript: ENSGACT00000015925
Sequence length 377
Comment pep:known_by_projection group:BROADS1:groupXIII:13714986:13754888:1 gene:ENSGACG00000012015 transcript:ENSGACT00000015925 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLDGIKMEDHPLRSGQAMLGVMLGGSDCHHPSVCEGCQRPISDRFLMRVNDSSWHEECLQ
CTVCQQPLTTSCYFRERKLYCKHDYQQLFATKCSGCMEKIAPTEFVMRALECVYHLNCFS
CCVCDRQLRKGDEFVLKEGQLLCKVDYEREKDLLSSVSPDDSDSEKSDDEELDIKQEKGI
GGQGKADDSKDPRRPKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQ
VWFQNQRAKMKKLARRQQQQQEQQNSQRLGQEVMSNRMEGMMNSFTPLAPPQQQLVAMDQ
NGYSTDPFQQGLTPPQMPGDHMNPYGNDSAFHDIDSDTSLTSLSDCFMASSDVNSMQARV
GNPIDRLYSMQNSYFAS
Download sequence
Identical sequences G3PE70
ENSGACP00000015894 ENSGACP00000015894 69293.ENSGACP00000015894

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]