SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000016563 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000016563
Domain Number 1 Region: 57-161
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.2e-32
Family Spermadhesin, CUB domain 0.00032
Further Details:      
 
Domain Number 2 Region: 178-302
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.42e-20
Family Spermadhesin, CUB domain 0.0038
Further Details:      
 
Domain Number 3 Region: 301-337
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000419
Family LDL receptor-like module 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000016563   Gene: ENSGACG00000012534   Transcript: ENSGACT00000016596
Sequence length 550
Comment pep:known_by_projection group:BROADS1:groupXIX:15937047:15940989:-1 gene:ENSGACG00000012534 transcript:ENSGACT00000016596 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSPNASFAVLLSLLFLEEGFALAQKTEDGGADSKGVRSSQRPKQPHQCGNWQRNTEGGSF
SSPNYPKTYPPNKECLYVLEALPRQRIELLFDQTFYIEASFECRFDHIEVRDGPFSFSPL
INRFCGSATPGLVLSSGRFMWIRFFSDDELEGIGFQVQYSFTAEDPEFHLHVGGLLNPIP
DCQFELSGADGLIRSSQVEEEYKVKQDQAVDCIWTIRAPANNRIYLRFLEYQMENSNECK
KNFVAVYDGSNAIEDLKAKFCSTVANDIMLDTGVGVVRMWADETSRLSRFKMLFTSFEDP
PCLGSAFFCHTNMCINTSLVCNGIQNCVFPWDESNCKEKKNKGVFHQITKTHGTVICVST
GVVLLLLIVSILVQVKQPRKKVLVRKNNLFHRGDSQEVFDPPRYELFTLRDKDMSADLGE
LSEELQSLQALRRSSSGSRCVHEHHCGSQASLNSVKAIHGAREMGRGSLELLPFRGDLQS
ALPTFRDLNSSMRKKSWPSMKPGRTQGRQGTADRTMGRQDRVMYDVYVRGAGSRRGNYEM
AQQRSLSMDF
Download sequence
Identical sequences G3PG39
69293.ENSGACP00000016563 ENSGACP00000016563 ENSGACP00000016563

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]