SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000017177 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGACP00000017177
Domain Number - Region: 5-35
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0863
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000017177   Gene: ENSGACG00000012987   Transcript: ENSGACT00000017211
Sequence length 222
Comment pep:known_by_projection group:BROADS1:groupVIII:16638723:16642591:-1 gene:ENSGACG00000012987 transcript:ENSGACT00000017211 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEAPPWPSRFFCHRCSAEISPRLPEYTCPRCDSGFIEELLEERSADNGATSTISSGPQN
QQPFENPDQHMFTFPSGYGQFALGVFDDRFDFGAGLGPEDNRDAENRRERETASRQRYGA
RQPRSRHGSRRQAGRPEGVPTLEGIIQQLVNGIIAPTAMPNIGVGPWGVLHSNPMDYAWG
ANGLDAIITQLLNQFENTGPPPADRDKIKTLPTVQITEEHVG
Download sequence
Identical sequences G3PHV1
ENSGACP00000017177

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]