SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000018381 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000018381
Domain Number 1 Region: 160-227
Classification Level Classification E-value
Superfamily Homeodomain-like 2.22e-21
Family Homeodomain 0.0029
Further Details:      
 
Domain Number 2 Region: 48-114
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000175
Family LIM domain 0.023
Further Details:      
 
Domain Number 3 Region: 18-45
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000107
Family LIM domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000018381   Gene: ENSGACG00000013917   Transcript: ENSGACT00000018416
Sequence length 287
Comment pep:known_by_projection group:BROADS1:groupXIII:17487802:17492454:-1 gene:ENSGACG00000013917 transcript:ENSGACT00000018416 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SAESSPSEAACLCSPAAKNRCASCGMEIHDRYLLKVNNLNWHSGCLECSVCRASLRQHNS
CYVKNKEIYCKLDYFSRFGTKCAQCGRQVYASDWVRRARGSVYHLACFACFSCKRQLSTG
EEFGLVEGRVLCRSHYDVMLDNLRRAAENGTGLTLEGALPSDQDCQPKPAKRARTSFTAE
QLQVMQSQFAQDNNPDAQTLQKLAEMTGLSRRVIQVWFQNCRARHKKQPPLSGYPPGAPM
SRMPPSLPDDVHYSPFGSPDRPHLLALHGYLDGRQNVASGQDCFPTQ
Download sequence
Identical sequences G3PLA1
ENSGACP00000018381 69293.ENSGACP00000018381 ENSGACP00000018381

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]