SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000018617 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000018617
Domain Number 1 Region: 505-729
Classification Level Classification E-value
Superfamily GFP-like 2.09e-79
Family Domain G2 of nidogen-1 0.00000081
Further Details:      
 
Domain Number 2 Region: 1257-1512
Classification Level Classification E-value
Superfamily YWTD domain 1.23e-39
Family YWTD domain 0.000000232
Further Details:      
 
Domain Number 3 Region: 1074-1153
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 7.46e-24
Family Thyroglobulin type-1 domain 0.00076
Further Details:      
 
Domain Number 4 Region: 994-1072
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 1.03e-22
Family Thyroglobulin type-1 domain 0.00079
Further Details:      
 
Domain Number 5 Region: 893-992
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 3.01e-22
Family Thyroglobulin type-1 domain 0.00072
Further Details:      
 
Domain Number 6 Region: 1157-1230
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 3.79e-20
Family Thyroglobulin type-1 domain 0.00074
Further Details:      
 
Domain Number 7 Region: 463-502,748-822
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000549
Family Growth factor receptor domain 0.021
Further Details:      
 
Domain Number 8 Region: 868-909
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000042
Family EGF-type module 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000018617   Gene: ENSGACG00000014091   Transcript: ENSGACT00000018653
Sequence length 1522
Comment pep:known_by_projection group:BROADS1:groupI:20846159:20873754:-1 gene:ENSGACG00000014091 transcript:ENSGACT00000018653 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RLGMLAACLLCWSCGVCLVSAIRRTDMYPYGPQSGDQVLAEGDDETSRVLPLSRPLTFYR
TRFSQLYVATNGIISAQDLPMEKQYVDDGFPTDFPAVAPFLADIDTSGGRGQIYYRVTET
PGVLNRVAQEVHQGFPDAKFTPTVAVVATWENVAAYEEQTRTTGPSSKVNTFQAVIGYDE
TDSYVIFLYPEGGLNFFGTRPKESYNVEIELPARVGFSRGEIPYLIFSRIEGPHYSVTSN
EQSVKNLYQVGNTGIPGVWLFHTGNSYYFDNIVPASFSGLLDTPPAGGLSLDTTTAEYEE
IEDNPDNTFGTDNQEEEDDYLLTDGDPEFQTGPTGDHSASPDAPSSPSEEPSRQAVYDIG
NVPLTSEPKYNSEPGERQYAPPNSPERAPVGGAQQQPQVTQNQLCIEMTYRVSPANPSDL
HFKNERRFSPGGHVGQRGRGMMWIFDTGRDEIMIQYTTENKETCASSRFQQECSQNAFCS
DYATGFCCHCRPGFYGNGRHCLPEGAPQRVSGKVNGTVTVGSTPVELNNIDLHAYIVVGD
GRAYTAISEVPEPVGWALMPLAPIGELFGWLFALELPNSQAGFKITGAEFTRHAEAIFYP
GNQRLSIVQTGHGIDNHNHLNVDTVVSGSVPFLPSGSEVTMDPFKEIYQYYPSVATSYSV
REFSVVSAERGSESFSFQLKQNITYRDCRHDNRAGVPETLQITMERVFVMYVKEERILRY
AITNKISPVGAEPTEPELVNPCYAGNHDCDTTAQCLPQQGQDFLCQCATGYRGDGRNCYD
VDECAEGSSSCGAHAQCVNLPGSHSCQCQGGFEFGFDRRSCVGIHIFVPAQAQHDQQRTA
AKAREHSGGAGRWATNGRAGVGMRGLMFSLDIDECSSSPCHISARCINALGSFQCQCEPG
FYGDGFHCSQQEDEPERPKTHCEHHRDSVQTTSSEGYPIVGAYVPQCDHNGRYIPSQCHG
STGHCWCVDVRGQEKAGTRTPPGTPPKDCDRSDEPERPKTHCEHHRDRVQTSSPEGYPVV
GAYVPQCDAGGQYTPLQCHGSTGHCWCVDSRGQERTGTRTPPGAPPTDCDKPDEPERPKT
HCEHHRDRVQTTSPEGYPIVGAYVPQCDDNGRYASLQCHGSTGHCWCVDSTGQERAGTRT
PPGSPPKDCDRPVPVAPTEHPESVCERWRASLIEHYGGKPQPEQYVPQCEQDGQFSPVQC
YGETTYCWCVDQDGREVPGTRSYDIVKPACLPSAAPPTVRPLPRPDVTPPPNADITLLYA
QGQKIGALPLNGTRLDAARSKTLLTLHGSIVVGIAHDCKENHVYWTDLSARTINRASMAA
GAEPEILINTNLVSPEGLAVDAKRRLMFWVDSNPDVIESANLDGSGRRTLFSTDLVNPRA
IIVVSSTGTLYWTDWNREAPKIESASVDGQNRRVVVTDGVGLPNALTYDSSSGQVCWADA
GTKRLECVSPDGSGRRVVHPSLNYPFSMVYYGNHFYYTDWRRDGVIAVSKESSQITDEYL
PDQRSHLYGIAIATTHCLSGNL
Download sequence
Identical sequences G3PLY6
ENSGACP00000018617 69293.ENSGACP00000018617 ENSGACP00000018617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]