SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000019017 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000019017
Domain Number 1 Region: 1087-1216,1258-1323
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000322
Family ABC transporter ATPase domain-like 0.085
Further Details:      
 
Domain Number 2 Region: 2641-2684
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000811
Family RING finger domain, C3HC4 0.016
Further Details:      
 
Domain Number 3 Region: 1435-1659
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000769
Family Extended AAA-ATPase domain 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000019017   Gene: ENSGACG00000014409   Transcript: ENSGACT00000019055
Sequence length 3824
Comment pep:known_by_projection scaffold:BROADS1:scaffold_112:156020:178413:-1 gene:ENSGACG00000014409 transcript:ENSGACT00000019055 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QGDGELLKRELRLMSETLDGSGRVKPEDGWVELRLRQIQEYRQLRQAAAAASAIRRIAER
TALSGDFREIDALGELEEDSFQERALGSLSADLHRAKHQLSAVTEQHTACLEEYLESQTL
VSWVKENLKDMSDVKVYVELASISAGENDAEIDQVACFHDAVMGYAPLLYGLRPHAGFED
FMRCARQVWDAQTRDEKLPDKLRESTRLLSWLKALKETHGSVEQSSLSLASSINAHGVYH
VGWSAHNTEKRCLQNMVAVTVTRGSEEKRYQLEELLELQNKLMLMSSRGEHGREQVNRFT
EVFEGVQRLGAILLQMQTSGNMLFRDWRAEVRCCPQQQPCIKATFPSLQGREVAYVGELT
ERLQALAHSMDACQREWSTFISEMRSSFNLLNHYTSEQMVYLSHWIHKVCHWEVPVPPQL
WLLLFPIKPQCTLTDVRVAHANAASRTSKPDQVENAESEDEDQNVSVPCMDEEDMRAPEM
WRKFKDDMPQYLNEYLDISSLGHVLSSLSEMNQELVNRNFPPVLQEGRPNLFFCPDAEVF
TSVLSFYMQSPEQPLPSTDEVLVCREETTEEEVQIFLRRALGKGAGRNWGKIYSLVNPGL
LGYDVSVALGELFECLERSGNPHYRLIIVSPVEHQHRYVPSYFSNDKVQAGVSLTAEAAR
KYLHGHFTHSQNTSPPSPAALVSPDQLSVWTVSSVRPAVAIGKSLFVERLFEKFQQKSPR
ANHIKIRLIEPSVDVDALIKSLSEKLAPLREQDPVLLHVDTAGVRSGLEELLFHLLVLGC
LSDSHGVLWRRNVAHLITVEVLRTHGSSQNQPKEILPTIHCRPPKEVNKLLPSRRVPNTF
DPLMDEQEFCSEGVQRPYQYLKVYSNNQTLDRFKYREGSRHGDTIDCVNQFLKYCGMQDP
SWAELKNFSWFLNVQLKDCENSVFCDPDFLADQLPGFKGFIVKFMILMSRDFASPSLNTS
DESPTLLVEDDLLARLTIRKRWENESHPYIFFNADRFSMSFLGFNVIRQRQNRLNAVDPQ
SHKVLIENVMSQKLFEDLERQRISLTEDFDGLPRADKIKRISCVVGAQKGITDRDFDPDP
TYELTADNVMKMLAIHMRFRCGIPVVIMGETGCGKTRLVRFLCALQREEKAVENMVLVKV
HGGTTAEMIYRKVREAERLARNNRRMHELDTILFFDEANTTEAIFAIKEILCDQSMKGEP
LKADSGLKIIAACNPYRKHSPEMVKRLERAGLGYRVKADETEDRLGKVPLRQLVYRVHPL
PPSMVSLVWDFGQLSDSTELSYIKQIVQRQVVNHSLPRDCKDIISNVLAASQKYMRSRKN
ECSFVSLRDVERSMKVLVWFYQHSGVLFNYCTTLTEGHKTLKCLILSVGVCYYPSLVDKE
QYLSVICQYFPEPLCCSTALQEEISSCQDFFLQNIQTRETIAKNVALKENVFLMVVCIEL
RIPLFLVGKPGSSKSLAKTVVSDAMQGQNSHCELFKKLKQVHMVSFQCSPHSSPEGIIGT
FRNCARFQKDKNMDEYVSVVVLDEIGLAEDSPQMPLKTLHPLLEDGCIDNDRPDPHMKVG
FVGISNWALDPAKMNRGIFVSRRDPSEDELVETAKGICSCSTQILLQIKHMFPSLAKAFL
SICSETTKNQFFGLRDYYSLVKMLFAVVKSTQQEPDGGHLVEAILRNFSGQPEGFDPVMF
FQEVVQNLMDFPRPSTLQMVKKNLDHDTSQLSRYLLLLTTNNAALHILQQQVFAKGGYPP
PEIVFGSGFPKDQEYAQICRNINRVKTCMETGRTVILLNMQNLYESLYDALNQYYVYLSK
QQYVDLGLGSHRVKCRVHTNFRLVVVEDQKKVYEHFPMPLINRLEKHRVDRSTDLEPWQH
RVLHKLKKWVEEFSGDAMADFKQWEIFVGYHGDACASALLQALERRAQKVEDAAETEEEE
ILDIAKCLLLNCATPDAVVRLKYSDLSNQEKEKLQRMYFQQQHHHSLRNFLEDCLIQHQG
STTFLEVTTFSGLLTRSDVRVVAPALGLQSERTLLLSLHQFDTEVSFCNKISRSVRGGGK
GGDQDVSPALHVLFIQMDLEETNCSDELIASAKYCTMNYLMSLEGPTCWVIFIVKVSRIP
SKSQYIGFQGGVWHSVHIDDLRDSDDMSLNLSVFCGTLISNLLHPALSGIEHLDDGQTAW
TRRDSQGDGAHLHSLALVRSCIQKAVGLLREPEGVTSRSMQRIHTLLTLLGAGQTQTQTR
FQEVLLSRMAEASAQREEVMCSPKEWVSSEAKKRQALQEGGTLRHTLWRRLQATVTPILA
SMLEVMDRFGNLDLLSDGRLSRGLRELWLDILADSQSLILTSLHNSSESDQEVPVHHFLV
LDGAEQSCTAPFSWLVRTHLESLWEESEFMPVTTEDGTGRILQFVSTFSSSRLGSHFQKL
SAEEQQEYGRLYLQDFLLLALKIKSHDEVFSRALLGCVSELQASVGAAAELSPAWIAAAG
KQFAPRLDCLRHMFLLQPQLAAAVAQQGSEGETHEMVEDIGALGVFVEQTKLLSVASLPE
CEFFVGRVASLQPCLDRVFAQRYRTLCSAGGLQRLDSIRSLWHGMLVVASFVQHVVFRVT
PKDSRLREVALKHCSLHLSLMQASPDVRSVDTLQQLIRVLNRFHDECIGQELRSGSAFTK
VCLSEIQEPAVLPCQHVFCLPCLQRCTQEQRRCPKCRTDLPPDFRPTVSPHVKAALQEQA
SVRDRCNAFFLEVVSRFCLSEGQTPGDGVVELLFSLLVSASGNAGDVYRTRALTPFLECV
DNSPVVRSVLPKLLLQHSFEQVKTHIQTYLKNLEENLLARDDRTELYLLFVNCFQDSLLC
SEAKGAQRNGEQQRRAEMVFLCSVAAGQTPRRHQDPAQFLLNIARLRVCLSEAARLLQGA
AGQGRPQGEEARYLQQVKAACESGADDWHRVYLVRALHRLSGVECILSLMNQPAWRWVFP
PSLLQLQRIIPTNLDQFLCCGTAYRDLRDAVGHVLLEKQSDSFAAQIQKHVCVPVCRSSL
LPLALFRQVTCRYKSPERSVLPPPQDLARLEELLKSVKPPEFRDFCAALLSNKIGGPSSD
LQIHALLCPQRQTLLELLVHLDSVVLSGNPVLVPLHQIACQPQNVKNYFLPTMPDDHMSE
VKQWFRDKKAQMYYCTNGHPCIVTECGRPVEMRDCPECGVLIGGERHQPVAGFTAVQSAQ
DQTRTGHILGDAEQRSEAPERQMTVAKSCILRLLTHLAMLQGVVRNDRRVGDMIHPRPRD
VQSFLWGHLEKDLCVLGKALDQNMDNTAVTVHLILNTCAEQPGSRGASLDLSTKQGRQLW
EKLVCDSAINPVLQHLQMNLAEAQDRIGGDDGLTGSPLMTLLSGDPGTMLSLPSDCPTHR
STFWTLPEYMTVERFTQLVGEAQGRISLPLLGLFLQKVPCVRQLHHLPELAALQSDLLRA
VPLSSHPAEQTVAQVLQKIPDGCQKKRILERVKTFMHVWNCLRAEVANSLNEIVAAYSSV
DVDFTAESSAEFLTPSRHGPGSSLRALVDFLLETHNSLVRASRPEDSEYSVPLESVSETQ
LTLCSPERELLPLVLSHCHYTLQKGGETDRSYDLPGIQTQLARRFLAGKPLIQAVTKYLN
RHLQDFSVVLNAVRDKIRQEPLKGSASSATRTVLRSYTDACDAVHVVEIGLRLLGKTGGD
PRARLLSYLADTLRMERQISSTVTKALGESRLEHSVFTWQLLTSWKSELMLNRNQDPFRR
LPPEFQQKLSEEERKELKVFLADVDVCAFSRELHEILLLKTSSAGTDQGYQPHWDIRSTL
EVHLEQKTPPVLLGLESLPEKITLGQAADVWRAAVEFKRRRFRG
Download sequence
Identical sequences G3PN34
ENSGACP00000019017 ENSGACP00000019017 69293.ENSGACP00000019017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]