SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000019720 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000019720
Domain Number 1 Region: 276-506
Classification Level Classification E-value
Superfamily SIS domain 3.95e-20
Family mono-SIS domain 0.00042
Further Details:      
 
Domain Number 2 Region: 54-156
Classification Level Classification E-value
Superfamily SIS domain 0.0000000979
Family mono-SIS domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000019720   Gene: ENSGACG00000014949   Transcript: ENSGACT00000019758
Sequence length 583
Comment pep:known_by_projection group:BROADS1:groupI:23443090:23447491:1 gene:ENSGACG00000014949 transcript:ENSGACT00000019758 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YEPSLPVSEKSNPLTRDMDRASAKCIVRMLQACDAQMFQDGTGTTYQRLLSEPVLETLTE
VAKKVEHILKHPRDSLIVLSGCGTSGRLAFLMASAFNRALRELDHGLVYSYIIAGGDRAL
LSSQEAPEDDAELGVLSLQRACEGQKSVLFIGISCGLSAPFVAGQLDFCLQHPEVYTPVL
VGFNPTHQARDERIPGCSFTFRSVVQRMQELAKRGGAFVVNPAVGPEAISGSSRMKGGSA
TKILLEAVLSAAHAAAFADTPITPMGIREDMSVHEKTLEITYAQAKGIGALLEAAGQSLR
RGGRLCYLGWGSLGTLGLVDASECVPTFGAGCEDVRGFISGGYRALNNNEGPLADKGPDF
SIAHQDFLHQVLPSLTDRDVVLLLYTHADRVGEVAELARAAREKTSNVHAVYHRVDGDTA
AAVQQVCKTKLVYINFQIFLFLVFYKKKFIRFYQWELSTKLVLNAVSTGAHVLKGKIYQN
YMVDVQVTNSKLYRRATRLLQKLSGCPESRCEEALLKAVYRVDELTADITSSDIIEHAQA
ARSATKAVPLALVCLLSDCSLLEAGTRLEREPIVREALEACLS
Download sequence
Identical sequences G3PQ35
ENSGACP00000019720 ENSGACP00000019720 69293.ENSGACP00000019720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]