SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000020043 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000020043
Domain Number 1 Region: 115-241
Classification Level Classification E-value
Superfamily Bromodomain 2.09e-37
Family Bromodomain 0.00012
Further Details:      
 
Domain Number 2 Region: 2-50
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000037
Family PHD domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000020043   Gene: ENSGACG00000015196   Transcript: ENSGACT00000020082
Sequence length 244
Comment pep:known_by_projection group:BROADS1:groupII:6430805:6433455:1 gene:ENSGACG00000015196 transcript:ENSGACT00000020082 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCRKGDNEDLLLLCDGCDKGCHTYCHKPKITSIPEGDWYCPACISKASGPSPKNKKPPSK
PLTSSGGGAKKGAEGKKSGKQAGNGEVAVDDPASSTPKKAAKDTSRKRKTEESSPAPPAA
NQESPVCVKRAKTAKDNNRDLGLCRVLLAELERHQDAWPFLTPVNMKSVPGYRKVIKKPM
DFTTIREKLVSSQYQNLETFIIDVNLVFDNCEKYNEDNSDIGRAGHNMRKFFEKRWTELL
KQTN
Download sequence
Identical sequences G3PR08
ENSGACP00000020043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]