SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000020198 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000020198
Domain Number 1 Region: 259-447
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.31e-37
Family Laminin G-like module 0.000000394
Further Details:      
 
Domain Number 2 Region: 463-660
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-29
Family Laminin G-like module 0.00012
Further Details:      
 
Domain Number 3 Region: 43-96
Classification Level Classification E-value
Superfamily GLA-domain 1.5e-19
Family GLA-domain 0.0005
Further Details:      
 
Domain Number 4 Region: 151-193
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000018
Family EGF-type module 0.013
Further Details:      
 
Domain Number 5 Region: 177-268
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000105
Family Growth factor receptor domain 0.024
Further Details:      
 
Domain Number 6 Region: 113-156
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000109
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000020198   Gene: ENSGACG00000015310   Transcript: ENSGACT00000020237
Sequence length 664
Comment pep:known_by_projection group:BROADS1:groupII:7717982:7727254:1 gene:ENSGACG00000015310 transcript:ENSGACT00000020237 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLTPTTRLPPAALLVLLVARWSHGKVSLSPEEAKQFLSRPRRANQVFEETKQGHLEREC
VEEKCSKEEAREVFENDPETDYFYPKYLACMEKFGDAEKKKQDLITCVHNIPDQCSPSPC
NARGTVRCEDKKGDFLCHCFTGWAGARCDKDVDECSKRNGGCDHECNNTMGSYRCSCHQG
YVLVERHIYCVDIYVDECDNPGVCGTARCENKKGGFGCSCDVGYVYDNETKSCVDVDECG
ADVCAEQCLNTLGSFRCFCDGRQGMKLGRDLRSCKTITPCMSPSLRRNSRSLYLGRMFSG
VPVVRLRFRRRVQTGFSAEFDFRSYDAEGVIFFAGGHLNSSWIVLAMHHGKLELQLKYGT
VSRVTSSGPVVNDGEWRKISVEEQGRSLVIKIDREAVMKIAVNGDLFTLNKGMHELNLTV
GGVPFREDGLVNQVNPRLDGCMKEWKWLTGEDTSIQETIRSNDNMQCFNTEKPGTYYPGT
GFALFNISYAKVHAFPSLASEPQSLSVQLTLRPTSAIGVLFALVHQDRVPLSIALADYHP
GTDEWRDFVLVSVSDVIVASSPAPLCDGESHEILVTISGNQTLLLVDGQAGRSEETDIST
DVLSQSSTFIGGLPDVSLVTTLVSAPYSGCMEVSVNGQPLDLDQAIHKHNDIRSHSCPLL
DSHQ
Download sequence
Identical sequences G3PRG3
ENSGACP00000020198 ENSGACP00000020198 69293.ENSGACP00000020198

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]