SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000020299 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000020299
Domain Number 1 Region: 498-792
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.7e-83
Family Protein kinases, catalytic subunit 0.00000000106
Further Details:      
 
Domain Number 2 Region: 209-411
Classification Level Classification E-value
Superfamily Fibronectin type III 1.27e-36
Family Fibronectin type III 0.00011
Further Details:      
 
Domain Number 3 Region: 1-84
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.49e-29
Family Ephrin receptor ligand binding domain 0.00012
Further Details:      
 
Domain Number 4 Region: 786-856
Classification Level Classification E-value
Superfamily SAM/Pointed domain 4.52e-20
Family SAM (sterile alpha motif) domain 0.00038
Further Details:      
 
Domain Number 5 Region: 139-208,246-265
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000247
Family Growth factor receptor domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000020299   Gene: ENSGACG00000015386   Transcript: ENSGACT00000020338
Sequence length 862
Comment pep:known_by_projection group:BROADS1:groupIII:7805083:7850927:1 gene:ENSGACG00000015386 transcript:ENSGACT00000020338 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QTFNMYYYESNNANLWFIKESQYVKIDTIAADESFTQVDVGDRVMKLNTEVRDISNLSKK
GFYLAFQDLGACIALVSVRVFYKKCPLTVLNLAQFPDTITGGDTALVEVRGVCVNASEEF
EAPKMYCSADGGWLVPIGRCVCKPGFEENKDGCQPCRPGTYKASATDAYCTKCPPHSSSP
QEQAFECVCERGFYRAETDPRSMACTRSPSAPENPISTVNETCITLEWSPPRDTGGRGDV
TYSLHCRKCSGDSRKCTPCGSSIHFVPRQFGLSSPTVLVTDLQPDSNYSFTVESQNGVSD
LSPTPKGTVVINVTTSQTEHSRVSVVLKERRSKDSVTLAWQGPERPDGAIVEYEVIYYEK
NQREQNYTVLKTRSNMMTVEGLKPGTTYVFRVRARTDGGYGTYGGEIELETSHEDVFPIG
DPNQSTILAVSIAGGIVLLVFLVTCFVVSGRHCGYIKAKQDPDEEKMQFQHGRVKLPGSR
IYIHPHTYEDPNQAVRDFAKEIDASNIRIERVIGAGEFGEVCSGRLRVQGKREIYVAIKS
LKAGYSDKQRKDFLSEASIMGQFDHPNIIRLEGVVTKCKPVMIITEFMENGSLDTFLKKH
DGQFTVIQLVGMLRGIASGMKYLSDMSYVHRDLAARNILVNSNLVCKVSDFGLSRVLEDD
PEAAYTTRGGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVISYGERPYWEMSNQDVI
KAIDEGYRLPAPMDCPVVLHQLMLDCWEKGRSDRPKFGQIVTILDKLIRNPASLRELANS
SACREDPSTPELSVNTVDEWLEAIKMGQYKENFSSAGYVSLDSILYISVSELAKMGVTLA
GHQKKILSSVENLQSQGTHVQV
Download sequence
Identical sequences G3PRR3
ENSGACP00000020299

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]