SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000020411 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000020411
Domain Number 1 Region: 178-427
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.85e-85
Family Eukaryotic proteases 0.000045
Further Details:      
 
Domain Number 2 Region: 39-99
Classification Level Classification E-value
Superfamily GLA-domain 2.55e-21
Family GLA-domain 0.00045
Further Details:      
 
Domain Number 3 Region: 86-125
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000264
Family EGF-type module 0.0035
Further Details:      
 
Domain Number 4 Region: 129-177
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000321
Family EGF-type module 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000020411   Gene: ENSGACG00000015464   Transcript: ENSGACT00000020450
Sequence length 440
Comment pep:known_by_projection group:BROADS1:groupI:27510324:27513498:1 gene:ENSGACG00000015464 transcript:ENSGACT00000020450 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWMRVFFTFVFVFSSCRSASGLLDTDRANVVQVRTRRYNSGWLEELQVGDLKRECLEERC
SYEEAREVFEHDRTTAEFWRTYSLPDACLSSPCQNGGSCSAQASSYSCFCLPRFSGLNCE
LDSTTVHESCLLENGGCDHFCEEDEGGRRLNCSCADGYFLDEDGRSCTSTGPIACGMVPV
LKQNQLESPDSLARIVGGTECPKGECPWQVLLLHKGKAFCGGVIYKPTWILTASHCMEDV
EVRFLEVIAGEHNTEVLEGTEQRLQVSQVITHQNYSKTTVDHDVALLRLAGPVRYSTYAV
PACLPTRRLAERELWAVGLHTVSGWGRMSEKGPTSDLLRRLRVPRIRTQRCQEESGVRLT
QNMFCAGYIEGRQDSCKGDSGGPLVTEYRGTWFLLGIVSWGRGCARPGQYGIYTRVSNYL
DWIHNHTAHIGEASALNGTA
Download sequence
Identical sequences G3PS25
ENSGACP00000020411 69293.ENSGACP00000020411 ENSGACP00000020411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]