SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000020433 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000020433
Domain Number 1 Region: 234-474
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 7.35e-79
Family Eukaryotic proteases 0.00000244
Further Details:      
 
Domain Number 2 Region: 38-101
Classification Level Classification E-value
Superfamily GLA-domain 7.91e-25
Family GLA-domain 0.00018
Further Details:      
 
Domain Number 3 Region: 127-171
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000301
Family EGF-type module 0.0035
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000020433
Domain Number - Region: 90-122
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0237
Family EGF-type module 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000020433   Gene: ENSGACG00000015474   Transcript: ENSGACT00000020472
Sequence length 498
Comment pep:known_by_projection group:BROADS1:groupI:27519240:27523423:1 gene:ENSGACG00000015474 transcript:ENSGACT00000020472 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFWFDQTSSVLLLLHLSAAHAIFLDGEAANQVLTRWRRANSFLEELKQGNLERECMEEAC
NHEEAREIFEDEAKTKEFWNKYFDGDACESTPCANQGVCTDAIGTYTCYCQAGYQGFNCE
IVIPELCENKNGGCEHFCKVERGNIHCSCADGYYLGSDDKSCDSNEPFRCGTVVTKSTRT
VFRYVRQNTTNGNGTVSKANGLKDTGSNVTTTAASLPNDYVLPDGAIFEDMVVPDMADMT
RIVNGENCPPGQCPWQALLLDEENVGFCGGTILTNYIILTAAHCMNKSRYIYVKLGEFDV
LVDDGNEATHTVETLITHSMYRKDTYNNDIALIKLATPIKFSRFILPACLPDPVFAEKVL
MRQEDGMVSGFGRLGERQETSTILQRLTMPYVDRNTCLQSTQLRISPRMFCAGYDTIAKD
ACQGDSGGPHVTRYSDTYFVTGIVSWGEGCAKKGKYGVYTQVSKYISWIRQGIDGLMQKG
RRGVRARRHQGAIERLVL
Download sequence
Identical sequences G3PS47
69293.ENSGACP00000020433 ENSGACP00000020433 ENSGACP00000020433

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]