SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000020574 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000020574
Domain Number 1 Region: 61-329
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 1.79e-41
Family PhyH-like 0.065
Further Details:      
 
Domain Number 2 Region: 894-951
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 6.72e-21
Family Tudor domain 0.00044
Further Details:      
 
Domain Number 3 Region: 952-1007
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.00000000000000496
Family Tudor domain 0.00015
Further Details:      
 
Domain Number 4 Region: 724-762
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000122
Family PHD domain 0.018
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000020574
Domain Number - Region: 818-868
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0128
Family PHD domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000020574   Gene: ENSGACG00000015597   Transcript: ENSGACT00000020613
Sequence length 1059
Comment pep:known_by_projection group:BROADS1:groupIII:8632145:8641795:1 gene:ENSGACG00000015597 transcript:ENSGACT00000020613 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGVISQNNGSKGIMTFYPTPEEFKNFSRYIAYVESQGAHKAGLAKIVPPKEWKPRSSY
DDIDDLVIPAPIQQVVTGQSGLFTQYNIQKKSMTVREFRKIANSDKFCSPHYDDFEELER
KYWKNVTFNPPIYGADVNGSLYDPDVKDWNICHLDTILDTVEHESGITIEGVNTPYLYFG
MWKTTFAWHTEDMDLYSINYLHFGEPKSWYCVPPEHGKRLERLAKGFFPGSSQNCEAFLR
HKMTLISPSILKKYGIPFEKITQEAGEFMVTFPYAYHAGFNHGFNCAESTNFATERWIEY
GKQAVLCSCRRDMVKISMDVFVKKFQPDRYEQWLAGRDVLPIDHRRPTPEAKEFLGESSN
DTATCGDDGERKREPADAASLGTPRSALNTQRIETKRHRVCLEVPDEVVPKDEDEDGAEQ
YGKRPRLILIPPRTTAQDGKRNKGIITFCNYTYISCLPKIDFLSLIKTRAPAISSQSQPG
NRYLSVSATPSWTEATAQPARKMGVASLLFHKTLSSKDALQVQSYTMEKQQQQHSHTQLQ
VHSYARAEGLVEPGRKEDKPKATSPAEAQAEQVSEEQSYCMSVVEKQQPQAQLCTLPRHH
PLIREAHSDNEEFMDEEFEQEEKEEWAKPLTQLWQCRPYNPEVEREYNKSLGQQAPYCSI
CLLFYTYHQSESSSGSSSVTLVNRPGGRQWSKPLIPEMCFNTQSSRSNDNGEGQLSNPHV
AEDGTSRLVSCAQCCVRVHTSCYGVPEDEGELDDWLCTRCEADATTEDCCLCSLRGGALQ
RANNDKWVHVLCAITVLEARFVSVTERGPVDLSAIPLPRFKLKCAYCRKRMKREVKGCCV
QCSHGRCSTAFHPTCAQAAGMIMNPDDWPFTVFITCHRHKAPGIPERNKASMRELAVGQR
VICKHKNGRYYHSEVVELTTATFYEVVFDDGSYSNNLFPEDIQNRDCVRLGPPTEGDAVQ
VRWTDGLIYGAKFLVSHSIPMYLVEFEDGSQITVKREDIYTLDENLPKRVKSRMSVASDM
RFELFSQSNVKQNSKRQRVINSRYREDYIEPVIYRAIME
Download sequence
Identical sequences G3PSI8
69293.ENSGACP00000020574 ENSGACP00000020574 ENSGACP00000020574

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]