SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000020803 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000020803
Domain Number 1 Region: 175-428
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.62e-77
Family Eukaryotic proteases 0.0000267
Further Details:      
 
Domain Number 2 Region: 39-100
Classification Level Classification E-value
Superfamily GLA-domain 6.9e-21
Family GLA-domain 0.00046
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000020803
Domain Number - Region: 127-175
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000218
Family EGF-type module 0.0067
Further Details:      
 
Domain Number - Region: 94-122
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0142
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000020803   Gene: ENSGACG00000015767   Transcript: ENSGACT00000020843
Sequence length 435
Comment pep:known_by_projection scaffold:BROADS1:scaffold_135:36318:39014:-1 gene:ENSGACG00000015767 transcript:ENSGACT00000020843 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRLFLFVPVMAALWSAAVLSVSVFSDPPEAHMLLRSRRANSFLEELKAPSMERECLEEK
CDFEEAREIFHTREATLEFWTVYTDGNQCHSNMCVHGACVDLYQDYACRCNHGYEGKYCD
QPQTATNCSLDNGGCDHDCWEGDDGLTRSCSCVAGFKLHTDSRKCVPTGPSSCGQLLIAR
SSYTQRKDGLQPWMVGGEVGKKGESPWQALLLNARGQFHCGGVLIDENWVLTAAHCLFET
GSTPPCVSPGDYERYRDEGTEATLRVTRAFKHPRYNSRTVDNDIALLRLQTPAPQSKFIV
PVCLPGRRTAERALHLNGTPTVVSGWGKDSLNSTTFSSALNVIKVPLVERAVCAQHMSHN
ISDNVLCAGVLGQKMDACEGDSGGPMVTLYRGTWFLLGLVSWGEGCGREDKLGVYTKVSN
YNEWINGVRQDWDKG
Download sequence
Identical sequences G3PT67
69293.ENSGACP00000020803 ENSGACP00000020803 ENSGACP00000020803

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]