SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000020871 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000020871
Domain Number 1 Region: 1994-2216
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 8.24e-82
Family Fibrinogen C-terminal domain-like 0.00000177
Further Details:      
 
Domain Number 2 Region: 1822-1988
Classification Level Classification E-value
Superfamily Fibronectin type III 3.54e-23
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 3 Region: 918-1087
Classification Level Classification E-value
Superfamily Fibronectin type III 6.13e-23
Family Fibronectin type III 0.00031
Further Details:      
 
Domain Number 4 Region: 1730-1819
Classification Level Classification E-value
Superfamily Fibronectin type III 6.28e-20
Family Fibronectin type III 0.00016
Further Details:      
 
Domain Number 5 Region: 639-737
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000707
Family Fibronectin type III 0.00074
Further Details:      
 
Domain Number 6 Region: 1643-1730
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000386
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 7 Region: 1192-1277
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000055
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 8 Region: 825-915
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000923
Family Fibronectin type III 0.0000669
Further Details:      
 
Domain Number 9 Region: 1376-1459
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000185
Family Fibronectin type III 0.0022
Further Details:      
 
Domain Number 10 Region: 1284-1368
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000321
Family Fibronectin type III 0.0031
Further Details:      
 
Domain Number 11 Region: 751-840
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000369
Family Fibronectin type III 0.0051
Further Details:      
 
Domain Number 12 Region: 1537-1639
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000143
Family Fibronectin type III 0.0028
Further Details:      
 
Domain Number 13 Region: 1102-1186
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000016
Family Fibronectin type III 0.0021
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000020871
Domain Number - Region: 296-320
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0186
Family EGF-type module 0.061
Further Details:      
 
Domain Number - Region: 266-289
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0251
Family EGF-type module 0.087
Further Details:      
 
Domain Number - Region: 328-351
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0272
Family Integrin beta EGF-like domains 0.064
Further Details:      
 
Domain Number - Region: 359-382
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0272
Family Integrin beta EGF-like domains 0.094
Further Details:      
 
Domain Number - Region: 513-537
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0293
Family Integrin beta EGF-like domains 0.086
Further Details:      
 
Domain Number - Region: 483-506
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0335
Family EGF-type module 0.074
Further Details:      
 
Domain Number - Region: 452-475
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0377
Family EGF-type module 0.039
Further Details:      
 
Domain Number - Region: 545-568
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0377
Family Integrin beta EGF-like domains 0.075
Further Details:      
 
Domain Number - Region: 390-413
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0963
Family EGF-type module 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000020871   Gene: ENSGACG00000015813   Transcript: ENSGACT00000020911
Sequence length 2223
Comment pep:known_by_projection group:BROADS1:groupXIV:1199420:1214142:1 gene:ENSGACG00000015813 transcript:ENSGACT00000020911 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ELLCFLFQPTPLMLHFSRTLSFGQRFKPISISMGTQRALSCFLLAALLSSSDAGLVKKIL
RHRRQTPQPAEEHNVTLPSGERPVVFSHVYNINVPASSLCSVDLDAPESARLRTRDAGVP
PDEHAAEHTVDGENQIVFTHRINVPRRACGCSEDLPGLKELMSRLEMLEGEVSALRDQCH
GGGGGACCGAQVTGEVATKPYCHGHGNYSAETCGCVCEPGWKGPNCTRPGPGTAGKRGRC
VHGELPCATDPGRAPTAPSLPCPKDCHGRGLCQNGTCRCDAGYAGEDCGGRTCANNCHGN
GFCADGACVCAAGFSGDDCSRLTCLNGCSDRGACFNGVCICQPGYQGADCSQLACLNDCN
GRGQCVNGRCACDVGFQGDDCAELSCPSDCLRRGRCLNGQCVCEEGFVGEDCGGRTCPSN
CHGRGECVEGRCECRVGFAGSDCGELSCPGDCRSRGRCVDGQCVCDEGFSGEDCGRRACP
NDCLARGRCVDGACVCRDGYSGDDCSALACPANCNGRGRCVDGRCACDSGHEGESCAQLS
CLNGCRDKGRCESGRCVCDEGFIGDDCSGGERLVTCSMCSLEISRGVKSFLLKTHLERNQ
VSRGRIRFAVLAALHTAARSLHSLCSGLKARGHVQDNSPFAPPPPSPVSPPKDLTVGEVT
PDTVELSWSNDMLVTEYLVTYVPTSPGGLHAEFTVSGDKAAATVKELEPGIEYQINVYAV
LSNATSVPVGARVATELPKPEGVIFKPRESSVRVMWDQLDIPFDGWEIYFRNPQKEENGE
VVSTLPPSQNWFVQSGLGPGQEYEVSINIIKNDTRGPRTSKRVTTKIDGPRQLEVKDVTD
SSALVVWFQPASPTDGLSMVYGPSADPSDKTRVDISPSDKQHSLGALRPDTEYKVSLVSR
SGGLASAPAVATFTTALDAPLDLQSLSQTDDSVTLEWTNSQADVGGYLVKYSPISGASHG
EELFPRGPGQTTRATITGLHPGTEYGIGVTATKNERQSLPATTNAATDIDPPTDLEGTES
TETSLALSWQRPRARVGAYRLEYSSEDGRVGEAEIPGAATSYVLSDLTPGMSYTLTLSAE
RGLSRSAPVTASASTGTEPEDELTVSGVTPDGFDLTWTLKAHGVYDSLTVAYKDARPLRD
AREAQLPGDAAGSRIRGLNASTEYQIKLYGITGSQRSALLEAVAVTVSQPVVGELYISNI
TSESFSISWNGTEGEFDGFTLELIDSDWLTEQKEYNVSRGVESLEVTGLRPGTDYVAYVS
GTYKGSRTSPVSIVASTAEEPDLSGLLVSNVTSDRFSLSWRAGAKAFDNFIVEVRESALP
SQAMGRALPGGARSTVMAGLKARTSYDIKLYASAGGRSTRPLFDVATTEDVPQLGPVAAS
PVSPHNLSLSWSAVSGHFDGFVVRVSDAEQRSDPLELRLPGEARNVTLTDLADATGYDIE
LYGISHGRHTPSVLAHAVTDIKSKLQNMRLHPFSTVLRNLRMHAQLALYCVLGLLNSVDN
QIFGLLITHNLCTRCPPDGFLSPPPTQNTIKPSPAPLPKVENLTISNVTPFGFRVSWAVQ
RRQEEQEEESAPSSGGFRHFHVAVTDSGWLLEPQEFTVPGNQSHLDVWGLITGIGYEVRL
TGVSESGLLSRPLTTVAATEAEPEVEHLFVSDVTADGFRLSWAADGDLFDRYVIRIRDAK
RAARPREYAAGGAERTKVLTGLASGTEYEIELYGVSLDQRSQPVSGVAQTALSTPRGLRF
SHVTGSSAVVHWSTPRSPVDNYRITYVPSEGGSPLSVTVDGDVFEALLPDMIPGKTYQVT
VSAVKGLEESDPTTDNVITALDRPRGLSVANVTDTSALLLWQPSVATVDGYVITYSADSV
SHVVEHVSGDTAAFQMGSLVPGTRYTVGVHATKESRRSDSAGTEFTTDVDPPRDVTAVNI
GADSATLTWKPPQAAVSGYTLSFYPAGGAVREVVLSPTASSYVMAELTRSTEYSVRLQAI
AGAQRSRHADAAFTTVGQLHRRPKDCAQVLLNGETSSGLHTVYVGGEQGPPVQVYCDMTT
DGGGWMVFLRRQNGKLDFFRNWKNYTVGFGNMNDEFWLGLSNLHKITNSGHYELRVDLRD
SGESAYAQYDRFTVAEPKTRYKVSVGSYSGTAGDSMSYHQGRPFSTYDNDNDIAVTNCAL
SYKGAFWYKNCHRVNLMGKYGDDSHSKGINWFHWKAHEHSIPFAEMKIRPADFGKFESRK
KRS
Download sequence
Identical sequences G3PTD5
ENSGACP00000020871 69293.ENSGACP00000020871 ENSGACP00000020871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]